Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTTQLQCP)

DOT Name Receptor-binding cancer antigen expressed on SiSo cells (EBAG9)
Synonyms Cancer-associated surface antigen RCAS1; Estrogen receptor-binding fragment-associated gene 9 protein
Gene Name EBAG9
Related Disease
Glioma ( )
Ovarian neoplasm ( )
Adenocarcinoma ( )
Anemia ( )
Breast carcinoma ( )
Breast neoplasm ( )
Cholangiocarcinoma ( )
Cholangitis ( )
Eclampsia ( )
Endometrial carcinoma ( )
Endometriosis ( )
Endometrium adenocarcinoma ( )
Endometrium neoplasm ( )
Epithelial ovarian cancer ( )
Gallbladder disease ( )
Gastric adenocarcinoma ( )
Gastric cancer ( )
Germ cell tumor ( )
Graft-versus-host disease ( )
Hepatocellular carcinoma ( )
Intrahepatic cholangiocarcinoma ( )
Lung cancer ( )
Lung carcinoma ( )
Nasal polyp ( )
Non-small-cell lung cancer ( )
Pancreatic cancer ( )
Pancreatic tumour ( )
Pre-eclampsia ( )
Primary biliary cholangitis ( )
Prostate cancer ( )
Prostate carcinoma ( )
Prostate neoplasm ( )
Squamous cell carcinoma ( )
Stomach cancer ( )
Urinary bladder neoplasm ( )
Uterine fibroids ( )
Breast cancer ( )
Classic Hodgkin lymphoma ( )
Epstein barr virus infection ( )
Advanced cancer ( )
Clear cell renal carcinoma ( )
Endometrial cancer ( )
Mesothelioma ( )
Renal cell carcinoma ( )
Rheumatoid arthritis ( )
UniProt ID
RCAS1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAITQFRLFKFCTCLATVFSFLKRLICRSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEW
TSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGI
PDGSTGFSSRLAATQDLPFIHQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLAD
REKRAAEQQRKKMEKEAQRLMKKEQNKIGVKLS
Function May participate in suppression of cell proliferation and induces apoptotic cell death through activation of interleukin-1-beta converting enzyme (ICE)-like proteases.
Tissue Specificity
Widely expressed. Expressed in ovary, testis, prostate, thymus, muscle and heart, but not in small intestine, colon, lymph nodes, or peripherical blood lymphocytes. The protein is not detected in any of the above organs.
KEGG Pathway
Estrogen sig.ling pathway (hsa04915 )
Reactome Pathway
Estrogen-dependent gene expression (R-HSA-9018519 )

Molecular Interaction Atlas (MIA) of This DOT

45 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Glioma DIS5RPEH Definitive Altered Expression [1]
Ovarian neoplasm DISEAFTY Definitive Biomarker [2]
Adenocarcinoma DIS3IHTY Strong Altered Expression [3]
Anemia DISTVL0C Strong Biomarker [4]
Breast carcinoma DIS2UE88 Strong Biomarker [5]
Breast neoplasm DISNGJLM Strong Biomarker [6]
Cholangiocarcinoma DIS71F6X Strong Altered Expression [7]
Cholangitis DIS9U3YN Strong Biomarker [7]
Eclampsia DISWPO8U Strong Altered Expression [8]
Endometrial carcinoma DISXR5CY Strong Altered Expression [9]
Endometriosis DISX1AG8 Strong Altered Expression [10]
Endometrium adenocarcinoma DISY6744 Strong Biomarker [11]
Endometrium neoplasm DIS6OS2L Strong Altered Expression [9]
Epithelial ovarian cancer DIS56MH2 Strong Biomarker [12]
Gallbladder disease DISA6W3T Strong Altered Expression [7]
Gastric adenocarcinoma DISWWLTC Strong Altered Expression [13]
Gastric cancer DISXGOUK Strong Biomarker [14]
Germ cell tumor DIS62070 Strong Altered Expression [15]
Graft-versus-host disease DIS0QADF Strong Biomarker [7]
Hepatocellular carcinoma DIS0J828 Strong Altered Expression [16]
Intrahepatic cholangiocarcinoma DIS6GOC8 Strong Altered Expression [7]
Lung cancer DISCM4YA Strong Altered Expression [17]
Lung carcinoma DISTR26C Strong Altered Expression [17]
Nasal polyp DISLP3XE Strong Biomarker [18]
Non-small-cell lung cancer DIS5Y6R9 Strong Biomarker [3]
Pancreatic cancer DISJC981 Strong Altered Expression [19]
Pancreatic tumour DIS3U0LK Strong Altered Expression [19]
Pre-eclampsia DISY7Q29 Strong Altered Expression [20]
Primary biliary cholangitis DIS43E0O Strong Biomarker [7]
Prostate cancer DISF190Y Strong Biomarker [21]
Prostate carcinoma DISMJPLE Strong Biomarker [21]
Prostate neoplasm DISHDKGQ Strong Altered Expression [22]
Squamous cell carcinoma DISQVIFL Strong Biomarker [23]
Stomach cancer DISKIJSX Strong Biomarker [14]
Urinary bladder neoplasm DIS7HACE Strong Biomarker [24]
Uterine fibroids DISBZRMJ Strong Altered Expression [25]
Breast cancer DIS7DPX1 moderate Biomarker [5]
Classic Hodgkin lymphoma DISV1LU6 moderate Biomarker [26]
Epstein barr virus infection DISOO0WT moderate Biomarker [26]
Advanced cancer DISAT1Z9 Disputed Biomarker [12]
Clear cell renal carcinoma DISBXRFJ Limited Biomarker [15]
Endometrial cancer DISW0LMR Limited Altered Expression [9]
Mesothelioma DISKWK9M Limited Altered Expression [27]
Renal cell carcinoma DISQZ2X8 Limited Biomarker [15]
Rheumatoid arthritis DISTSB4J Limited Biomarker [28]
------------------------------------------------------------------------------------
⏷ Show the Full List of 45 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
11 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Receptor-binding cancer antigen expressed on SiSo cells (EBAG9). [29]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Receptor-binding cancer antigen expressed on SiSo cells (EBAG9). [30]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Receptor-binding cancer antigen expressed on SiSo cells (EBAG9). [31]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Receptor-binding cancer antigen expressed on SiSo cells (EBAG9). [32]
Fulvestrant DM0YZC6 Approved Fulvestrant decreases the expression of Receptor-binding cancer antigen expressed on SiSo cells (EBAG9). [33]
Diethylstilbestrol DMN3UXQ Approved Diethylstilbestrol decreases the expression of Receptor-binding cancer antigen expressed on SiSo cells (EBAG9). [34]
Genistein DM0JETC Phase 2/3 Genistein increases the expression of Receptor-binding cancer antigen expressed on SiSo cells (EBAG9). [32]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Receptor-binding cancer antigen expressed on SiSo cells (EBAG9). [35]
Trichostatin A DM9C8NX Investigative Trichostatin A affects the expression of Receptor-binding cancer antigen expressed on SiSo cells (EBAG9). [37]
[3H]methyltrienolone DMTSGOW Investigative [3H]methyltrienolone increases the expression of Receptor-binding cancer antigen expressed on SiSo cells (EBAG9). [38]
Daidzein DMRFTJX Investigative Daidzein increases the expression of Receptor-binding cancer antigen expressed on SiSo cells (EBAG9). [32]
------------------------------------------------------------------------------------
⏷ Show the Full List of 11 Drug(s)
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the phosphorylation of Receptor-binding cancer antigen expressed on SiSo cells (EBAG9). [36]
1,6-hexamethylene diisocyanate DMLB3RT Investigative 1,6-hexamethylene diisocyanate increases the methylation of Receptor-binding cancer antigen expressed on SiSo cells (EBAG9). [39]
------------------------------------------------------------------------------------

References

1 Clinico-pathological significance of RCAS1 expression in gliomas: a potential mechanism of tumor immune escape.Cancer Lett. 2007 Feb 8;246(1-2):182-9. doi: 10.1016/j.canlet.2006.02.021. Epub 2006 Apr 3.
2 Expression of EBAG9/RCAS1 is associated with advanced disease in human epithelial ovarian cancer.Br J Cancer. 2004 Jun 1;90(11):2197-202. doi: 10.1038/sj.bjc.6601832.
3 The clinical and pathological significance of RCAS1 expression as a prognostic biomarker in non-small cell lung cancer.In Vivo. 2014 May-Jun;28(3):375-81.
4 A novel mechanism in suppression of erythropoiesis during inflammation: a crucial role of RCAS1.Eur J Haematol. 2005 May;74(5):365-73. doi: 10.1111/j.1600-0609.2004.00389.x.
5 Breast cancer, placenta and pregnancy.Eur J Cancer. 2019 Jul;115:68-78. doi: 10.1016/j.ejca.2019.03.021. Epub 2019 May 20.
6 RCAS1 is associated with ductal breast cancer progression.Biochem Biophys Res Commun. 2002 May 24;293(5):1544-9. doi: 10.1016/S0006-291X(02)00401-1.
7 The tumor-associated antigen, RCAS1, can be expressed in immune-mediated diseases as well as in carcinomas of biliary tract.J Hepatol. 2002 Jun;36(6):786-92. doi: 10.1016/s0168-8278(02)00066-1.
8 The human tumor-associated antigen RCAS1 in pregnancies complicated by pre-eclampsia.J Reprod Immunol. 2008 Jan;77(1):100-8. doi: 10.1016/j.jri.2007.05.001. Epub 2007 Jul 2.
9 Expression of receptor-binding cancer antigen expressed on SiSo cells and estrogen receptor subtypes in the normal, hyperplastic, and carcinomatous endometrium.Int J Gynecol Cancer. 2008 Jan-Feb;18(1):152-8. doi: 10.1111/j.1525-1438.2007.00966.x. Epub 2007 Apr 26.
10 Comparison of RCAS1 and metallothionein expression and the presence and activity of immune cells in human ovarian and abdominal wall endometriomas.Reprod Biol Endocrinol. 2006 Aug 14;4:41. doi: 10.1186/1477-7827-4-41.
11 A highly polymorphic CA repeat marker at the EBAG9/RCAS1 locus on 8q23 that detected frequent multiplication in breast cancer.Ann Hum Biol. 2002 Jul-Aug;29(4):457-60. doi: 10.1080/03014460110087762.
12 Cytoplasmic and membranous receptor-binding cancer antigens expressed on SiSo cells (RCAS1) immunoreactivity in epithelial ovarian cancer cells represent differing biological function of RCAS1.Folia Histochem Cytobiol. 2019;57(3):116-126. doi: 10.5603/FHC.a2019.0012. Epub 2019 Aug 7.
13 Increased RCAS1 expression is associated with advanced histopathological stage and poor prognosis in patients with gastric adenocarcinoma.Dis Markers. 2013;35(4):213-9. doi: 10.1155/2013/527548. Epub 2013 Sep 3.
14 Aberrant intracellular localization of RCAS1 is associated with tumor progression of gastric cancer.Int J Oncol. 2001 Oct;19(4):695-700. doi: 10.3892/ijo.19.4.695.
15 Estrogen receptor-binding fragment-associated gene 9 expression and its clinical significance in human testicular cancer.Int J Urol. 2009 Mar;16(3):329-32. doi: 10.1111/j.1442-2042.2008.02233.x. Epub 2009 Jan 20.
16 Gene and protein expression of RCAS1 in hepatocellular carcinoma.Anticancer Res. 2003 Nov-Dec;23(6D):4967-71.
17 Diagnostic and prognostic significance of receptor-binding cancer antigen expressed on SiSo cells in lung-cancer-associated pleural effusion.Clin Respir J. 2018 Jan;12(1):279-284. doi: 10.1111/crj.12527. Epub 2016 Jul 21.
18 The evaluation of metallothionein expression in nasal polyps with respect to immune cell presence and activity.BMC Immunol. 2010 Mar 9;11:10. doi: 10.1186/1471-2172-11-10.
19 Receptor-binding cancer antigen expressed on SiSo cells can be detected in metastatic lymph nodes from gastrointestinal cancers.World J Gastroenterol. 2005 Oct 14;11(38):6014-7. doi: 10.3748/wjg.v11.i38.6014.
20 RCAS1 decidual immunoreactivity in severe pre-eclampsia: immune cell presence and activity.Am J Reprod Immunol. 2007 Oct;58(4):358-66. doi: 10.1111/j.1600-0897.2007.00521.x.
21 Extracellular vesicle-mediated EBAG9 transfer from cancer cells to tumor microenvironment promotes immune escape and tumor progression.Oncogenesis. 2018 Jan 24;7(1):7. doi: 10.1038/s41389-017-0022-6.
22 EBAG9/RCAS1 expression and its prognostic significance in prostatic cancer.Int J Cancer. 2003 Sep 1;106(3):310-5. doi: 10.1002/ijc.11205.
23 Apoptotic function of tumor-associated antigen RCAS1 in oral squamous cell carcinoma.J Transl Med. 2014 May 6;12:112. doi: 10.1186/1479-5876-12-112.
24 EBAG9 is a tumor-promoting and prognostic factor for bladder cancer.Int J Cancer. 2009 Feb 15;124(4):799-805. doi: 10.1002/ijc.23982.
25 Alterations in RCAS1 serum concentration levels during menstrual cycle in patients with uterine leiomyoma and lack of analogical changes in adenomyosis.Gynecol Obstet Invest. 2009;67(3):195-201. doi: 10.1159/000188045. Epub 2008 Dec 20.
26 Expression of human tumor-associated antigen RCAS1 in Reed-Sternberg cells in association with Epstein-Barr virus infection: a potential mechanism of immune evasion.Int J Cancer. 2001 Jul 1;93(1):91-6. doi: 10.1002/ijc.1300.
27 Clinical significance of the expression of tumor-associated antigen, RCAS1, and its soluble protein in pleural fluid in malignant mesothelioma.Oncol Rep. 2005 Aug;14(2):357-62.
28 Downregulation of RCAS1 and upregulation of cytotoxic T cells affects synovial proliferation and apoptosis in rheumatoid arthritis.J Rheumatol. 2008 Sep;35(9):1716-22. Epub 2008 Aug 1.
29 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
30 Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
31 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
32 Phytoestrogens activate estrogen receptor beta1 and estrogenic responses in human breast and bone cancer cell lines. Mol Nutr Food Res. 2007 Feb;51(2):171-7. doi: 10.1002/mnfr.200600091.
33 Arsenite and cadmium promote the development of mammary tumors. Carcinogenesis. 2020 Jul 14;41(7):1005-1014. doi: 10.1093/carcin/bgz176.
34 Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
35 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
36 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
37 A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
38 Analysis of the prostate cancer cell line LNCaP transcriptome using a sequencing-by-synthesis approach. BMC Genomics. 2006 Sep 29;7:246. doi: 10.1186/1471-2164-7-246.
39 DNA methylation modifies urine biomarker levels in 1,6-hexamethylene diisocyanate exposed workers: a pilot study. Toxicol Lett. 2014 Dec 1;231(2):217-26. doi: 10.1016/j.toxlet.2014.10.024. Epub 2014 Oct 22.