Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUAXDAY)

DOT Name Bcl-2-binding component 3, isoforms 3/4 (BBC3)
Synonyms JFY-1; p53 up-regulated modulator of apoptosis
Gene Name BBC3
UniProt ID
BBC3B_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MKFGMGSAQACPCQVPRAASTTWVPCQICGPRERHGPRTPGGQLPGARRGPGPRRPAPLP
ARPPGALGSVLRPLRARPGCRPRRPHPAARCLPLRPHRPTRRHRRPGGFPLAWGSPQPAP
RPAPGRSSALALAGGAAPGVARAQRPGGSGGRSHPGGPGSPRGGGTVGPGDRGPAAADGG
RPQRTVRAAETRGAAAAPPLTLEGPVQSHHGTPALTQGPQSPRDGAQLGACTRPVDVRDS
GGRPLPPPDTLASAGDFLCTM
Function [Isoform 3]: Does not affect cell growth.
KEGG Pathway
Platinum drug resistance (hsa01524 )
p53 sig.ling pathway (hsa04115 )
Apoptosis (hsa04210 )
Apoptosis - multiple species (hsa04215 )
Hippo sig.ling pathway (hsa04390 )
Huntington disease (hsa05016 )
Measles (hsa05162 )
Pathways in cancer (hsa05200 )
Colorectal cancer (hsa05210 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 1 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Venetoclax DM8I94Y Approved Bcl-2-binding component 3, isoforms 3/4 (BBC3) affects the response to substance of Venetoclax. [33]
------------------------------------------------------------------------------------
73 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [1]
Doxorubicin DMVP5YE Approved Doxorubicin increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [2]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [3]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [4]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [5]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [6]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [7]
Vorinostat DMWMPD4 Approved Vorinostat increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [8]
Testosterone DM7HUNW Approved Testosterone decreases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [9]
Methotrexate DM2TEOL Approved Methotrexate increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [10]
Decitabine DMQL8XJ Approved Decitabine increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [11]
Phenobarbital DMXZOCG Approved Phenobarbital affects the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [12]
Menadione DMSJDTY Approved Menadione affects the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [7]
Fluorouracil DMUM7HZ Approved Fluorouracil increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [4]
Dexamethasone DMMWZET Approved Dexamethasone decreases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [13]
Niclosamide DMJAGXQ Approved Niclosamide increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [14]
Bortezomib DMNO38U Approved Bortezomib increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [15]
Hydroquinone DM6AVR4 Approved Hydroquinone increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [16]
Aspirin DM672AH Approved Aspirin increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [17]
Etoposide DMNH3PG Approved Etoposide increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [18]
Paclitaxel DMLB81S Approved Paclitaxel increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [4]
Indomethacin DMSC4A7 Approved Indomethacin increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [19]
Cidofovir DMA13GD Approved Cidofovir increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [20]
Simvastatin DM30SGU Approved Simvastatin increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [21]
Sulindac DM2QHZU Approved Sulindac increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [22]
Methamphetamine DMPM4SK Approved Methamphetamine increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [23]
Nefazodone DM4ZS8M Approved Nefazodone increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [24]
Dactinomycin DM2YGNW Approved Dactinomycin increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [25]
Dopamine DMPGUCF Approved Dopamine increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [26]
Nitric Oxide DM1RBYG Approved Nitric Oxide increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [27]
Morphine DMRMS0L Approved Morphine increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [28]
Penicillamine DM40EF6 Approved Penicillamine decreases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [29]
Chlorambucil DMRKE63 Approved Chlorambucil increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [30]
Nicotinamide DMUPE07 Approved Nicotinamide increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [31]
Fludarabine DMVRLT7 Approved Fludarabine increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [2]
Pemetrexed DMMX2E6 Approved Pemetrexed increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [32]
Dextroamphetamine DMMIHVP Approved Dextroamphetamine increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [23]
Pitavastatin DMJH792 Approved Pitavastatin increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [33]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [34]
Berberine DMC5Q8X Phase 4 Berberine increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [31]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [35]
Resveratrol DM3RWXL Phase 3 Resveratrol increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [36]
Curcumin DMQPH29 Phase 3 Curcumin increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [37]
Fenretinide DMRD5SP Phase 3 Fenretinide increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [38]
HMPL-004 DM29XGY Phase 3 HMPL-004 increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [39]
Bardoxolone methyl DMODA2X Phase 3 Bardoxolone methyl increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [39]
MLN4924 DMP36KD Phase 3 MLN4924 affects the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [40]
Avastin+/-Tarceva DMA86FL Phase 3 Avastin+/-Tarceva increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [19]
5-methoxypsoralen DME2A8X Phase 3 5-methoxypsoralen increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [41]
Selinexor DMBD4K3 Phase 3 Selinexor increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [42]
Amiodarone DMUTEX3 Phase 2/3 Trial Amiodarone increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [43]
GSK2110183 DMZHB37 Phase 2 GSK2110183 increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [44]
Gossypol DMJWE3I Phase 2 Gossypol increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [45]
Duvelisib DM7USVA Phase 2 Trial Duvelisib increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [46]
VS-5584 DMMO3G5 Phase 1 VS-5584 increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [48]
GSK690693 DMRBVHE Phase 1 GSK690693 increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [32]
PMID26394986-Compound-22 DM43Z1G Patented PMID26394986-Compound-22 increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [50]
THAPSIGARGIN DMDMQIE Preclinical THAPSIGARGIN increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [51]
Dioscin DM5H2W9 Preclinical Dioscin increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [52]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [53]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [54]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [55]
Coumarin DM0N8ZM Investigative Coumarin increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [56]
Sulforaphane DMQY3L0 Investigative Sulforaphane increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [39]
3R14S-OCHRATOXIN A DM2KEW6 Investigative 3R14S-OCHRATOXIN A decreases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [57]
Paraquat DMR8O3X Investigative Paraquat increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [58]
Nickel chloride DMI12Y8 Investigative Nickel chloride increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [59]
Kaempferol DMHEMUB Investigative Kaempferol increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [60]
LICOAGROCHACONE A DMWY0TN Investigative LICOAGROCHACONE A increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [61]
Phenanthrene-9,10-dione DMG8KS9 Investigative Phenanthrene-9,10-dione increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [62]
Methylenedioxymethamphetamine DMYVU47 Investigative Methylenedioxymethamphetamine increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [23]
[3H]CP55940 DMU7FC5 Investigative [3H]CP55940 increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [63]
2-Amino-1-(4-methylthiophenyl)propane DMJ2Z9G Investigative 2-Amino-1-(4-methylthiophenyl)propane increases the expression of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [23]
------------------------------------------------------------------------------------
⏷ Show the Full List of 73 Drug(s)
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [47]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the phosphorylation of Bcl-2-binding component 3, isoforms 3/4 (BBC3). [49]
------------------------------------------------------------------------------------

References

1 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
2 MDM2 antagonists activate p53 and synergize with genotoxic drugs in B-cell chronic lymphocytic leukemia cells. Blood. 2006 May 15;107(10):4109-14. doi: 10.1182/blood-2005-08-3273. Epub 2006 Jan 26.
3 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
4 Administration of PUMA adenovirus increases the sensitivity of esophageal cancer cells to anticancer drugs. Cancer Biol Ther. 2006 Apr;5(4):380-5. doi: 10.4161/cbt.5.4.2477. Epub 2006 Apr 4.
5 Research resource: STR DNA profile and gene expression comparisons of human BG-1 cells and a BG-1/MCF-7 clonal variant. Mol Endocrinol. 2014 Dec;28(12):2072-81.
6 Improved apoptotic cell death in drug-resistant non-small-cell lung cancer cells by tumor necrosis factor-related apoptosis-inducing ligand-based treatment. J Pharmacol Exp Ther. 2014 Mar;348(3):360-71. doi: 10.1124/jpet.113.210054. Epub 2013 Dec 17.
7 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
8 Suberoylanilide hydroxamic acid (Zolinza/vorinostat) sensitizes TRAIL-resistant breast cancer cells orthotopically implanted in BALB/c nude mice. Mol Cancer Ther. 2009 Jun;8(6):1596-605. doi: 10.1158/1535-7163.MCT-08-1004. Epub 2009 Jun 9.
9 The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
10 Methotrexate induces apoptosis through p53/p21-dependent pathway and increases E-cadherin expression through downregulation of HDAC/EZH2. Biochem Pharmacol. 2011 Feb 15;81(4):510-7. doi: 10.1016/j.bcp.2010.11.014. Epub 2010 Nov 27.
11 5-Aza-2'-deoxycytidine sensitizes busulfan-resistant myeloid leukemia cells by regulating expression of genes involved in cell cycle checkpoint and apoptosis. Leuk Res. 2010 Mar;34(3):364-72. doi: 10.1016/j.leukres.2009.08.014. Epub 2009 Sep 3.
12 Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
13 Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
14 Mitochondrial uncoupling reveals a novel therapeutic opportunity for p53-defective cancers. Nat Commun. 2018 Sep 26;9(1):3931.
15 The anti-apoptotic protein BCL2L1/Bcl-xL is neutralized by pro-apoptotic PMAIP1/Noxa in neuroblastoma, thereby determining bortezomib sensitivity independent of prosurvival MCL1 expression. J Biol Chem. 2010 Mar 5;285(10):6904-12. doi: 10.1074/jbc.M109.038331. Epub 2010 Jan 5.
16 In vitro effects of aldehydes present in tobacco smoke on gene expression in human lung alveolar epithelial cells. Toxicol In Vitro. 2013 Apr;27(3):1072-81.
17 Aspirin induces apoptosis in human leukemia cells independently of NF-kappaB and MAPKs through alteration of the Mcl-1/Noxa balance. Apoptosis. 2010 Feb;15(2):219-29. doi: 10.1007/s10495-009-0424-9.
18 Essential role of caspase-8 in p53/p73-dependent apoptosis induced by etoposide in head and neck carcinoma cells. Mol Cancer. 2011 Jul 31;10:95. doi: 10.1186/1476-4598-10-95.
19 Indomethacin and juglone inhibit inflammatory molecules to induce apoptosis in colon cancer cells. J Biochem Mol Toxicol. 2020 Feb;34(2):e22433. doi: 10.1002/jbt.22433. Epub 2020 Jan 9.
20 Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
21 Simvastatin inactivates beta1-integrin and extracellular signal-related kinase signaling and inhibits cell proliferation in head and neck squamous cell carcinoma cells. Cancer Sci. 2007 Jun;98(6):890-9.
22 Expression profile analysis of colon cancer cells in response to sulindac or aspirin. Biochem Biophys Res Commun. 2002 Mar 29;292(2):498-512.
23 An insight into the hepatocellular death induced by amphetamines, individually and in combination: the involvement of necrosis and apoptosis. Arch Toxicol. 2013 Dec;87(12):2165-85. doi: 10.1007/s00204-013-1082-9. Epub 2013 Jul 3.
24 Involvement of mitochondrial dysfunction in nefazodone-induced hepatotoxicity. Food Chem Toxicol. 2016 Aug;94:148-58. doi: 10.1016/j.fct.2016.06.001. Epub 2016 Jun 8.
25 Actinomycin D upregulates proapoptotic protein Puma and downregulates Bcl-2 mRNA in normal peripheral blood lymphocytes. Anticancer Drugs. 2007 Aug;18(7):763-72. doi: 10.1097/CAD.0b013e3280adc905.
26 Effects of dopamine on LC3-II activation as a marker of autophagy in a neuroblastoma cell model. Neurotoxicology. 2009 Jul;30(4):658-65. doi: 10.1016/j.neuro.2009.04.007. Epub 2009 May 4.
27 Apoptotic signaling pathways induced by nitric oxide in human lymphoblastoid cells expressing wild-type or mutant p53. Cancer Res. 2004 May 1;64(9):3022-9. doi: 10.1158/0008-5472.can-03-1880.
28 Morphine induces DNA damage and P53 activation in CD3+ T cells. Biochim Biophys Acta. 2009 Aug;1790(8):793-9. doi: 10.1016/j.bbagen.2009.04.011. Epub 2009 May 3.
29 D-Penicillamine targets metastatic melanoma cells with induction of the unfolded protein response (UPR) and Noxa (PMAIP1)-dependent mitochondrial apoptosis. Apoptosis. 2012 Oct;17(10):1079-94.
30 Differential gene expression induction by TRAIL in B chronic lymphocytic leukemia (B-CLL) cells showing high versus low levels of Zap-70. J Cell Physiol. 2007 Oct;213(1):229-36. doi: 10.1002/jcp.21116.
31 Concurrent acetylation of FoxO1/3a and p53 due to sirtuins inhibition elicit Bim/PUMA mediated mitochondrial dysfunction and apoptosis in berberine-treated HepG2 cells. Toxicol Appl Pharmacol. 2016 Jan 15;291:70-83. doi: 10.1016/j.taap.2015.12.006. Epub 2015 Dec 19.
32 Xanthohumol inhibits non-small cell lung cancer by activating PUMA-mediated apoptosis. Toxicology. 2022 Mar 30;470:153141. doi: 10.1016/j.tox.2022.153141. Epub 2022 Mar 5.
33 Statin-induced Mitochondrial Priming Sensitizes Multiple Myeloma Cells to BCL2 and MCL-1 Inhibitors. Cancer Res Commun. 2023 Dec 8;3(12):2497-2509. doi: 10.1158/2767-9764.CRC-23-0350.
34 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
35 Identification of histone deacetylase inhibitors with benzoylhydrazide scaffold that selectively inhibit class I histone deacetylases. Chem Biol. 2015 Feb 19;22(2):273-84. doi: 10.1016/j.chembiol.2014.12.015.
36 Natural products induce a G protein-mediated calcium pathway activating p53 in cancer cells. Toxicol Appl Pharmacol. 2015 Nov 1;288(3):453-62. doi: 10.1016/j.taap.2015.08.016. Epub 2015 Sep 1.
37 Involvement of Bcl-2 family members, phosphatidylinositol 3'-kinase/AKT and mitochondrial p53 in curcumin (diferulolylmethane)-induced apoptosis in prostate cancer. Int J Oncol. 2007 Apr;30(4):905-18.
38 BBC3 mediates fenretinide-induced cell death in neuroblastoma. Oncogene. 2005 Dec 1;24(54):7976-83. doi: 10.1038/sj.onc.1208947.
39 Mapping the dynamics of Nrf2 antioxidant and NFB inflammatory responses by soft electrophilic chemicals in human liver cells defines the transition from adaptive to adverse responses. Toxicol In Vitro. 2022 Oct;84:105419. doi: 10.1016/j.tiv.2022.105419. Epub 2022 Jun 17.
40 The Nedd8-activating enzyme inhibitor MLN4924 thwarts microenvironment-driven NF-B activation and induces apoptosis in chronic lymphocytic leukemia B cells. Clin Cancer Res. 2014 Mar 15;20(6):1576-89. doi: 10.1158/1078-0432.CCR-13-0987.
41 Bergapten induces G1 arrest and pro-apoptotic cascade in colorectal cancer cells associating with p53/p21/PTEN axis. Environ Toxicol. 2019 Mar;34(3):303-311. doi: 10.1002/tox.22685. Epub 2018 Dec 21.
42 The synergy of the XPO1 inhibitors combined with the BET inhibitor INCB057643 in high-grade B-cell lymphoma via downregulation of MYC expression. Sci Rep. 2023 Oct 29;13(1):18554. doi: 10.1038/s41598-023-45721-z.
43 Capturing time-dependent activation of genes and stress-response pathways using transcriptomics in iPSC-derived renal proximal tubule cells. Cell Biol Toxicol. 2023 Aug;39(4):1773-1793. doi: 10.1007/s10565-022-09783-5. Epub 2022 Dec 31.
44 Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
45 -(-)Gossypol promotes the apoptosis of bladder cancer cells in vitro. Pharmacol Res. 2008 Nov-Dec;58(5-6):323-31. doi: 10.1016/j.phrs.2008.09.005. Epub 2008 Sep 16.
46 Duvelisib treatment is associated with altered expression of apoptotic regulators that helps in sensitization of chronic lymphocytic leukemia cells to venetoclax (ABT-199). Leukemia. 2017 Sep;31(9):1872-1881. doi: 10.1038/leu.2016.382. Epub 2016 Dec 26.
47 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
48 VS-5584 as a PI3K/mTOR inhibitor enhances apoptotic effects of subtoxic dose arsenic trioxide via inhibition of NF-B activity in B cell precursor-acute lymphoblastic leukemia. Biomed Pharmacother. 2018 Jun;102:428-437. doi: 10.1016/j.biopha.2018.03.009. Epub 2018 Mar 23.
49 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
50 Celecoxib induces p53-PUMA pathway for apoptosis in human colorectal cancer cells. Chem Biol Interact. 2008 Oct 22;176(1):48-57. doi: 10.1016/j.cbi.2008.07.012. Epub 2008 Aug 8.
51 Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
52 Molecular mechanism and inhibitory targets of dioscin in HepG2 cells. Food Chem Toxicol. 2018 Oct;120:143-154.
53 Fermentation Extract of Naringenin Increases the Expression of Estrogenic Receptor and Modulates Genes Related to the p53 Signalling Pathway, miR-200c and miR-141 in Human Colon Cancer Cells Exposed to BPA. Molecules. 2022 Oct 5;27(19):6588. doi: 10.3390/molecules27196588.
54 Physical association of HDAC1 and HDAC2 with p63 mediates transcriptional repression and tumor maintenance in squamous cell carcinoma. Cancer Res. 2011 Jul 1;71(13):4373-9. doi: 10.1158/0008-5472.CAN-11-0046. Epub 2011 Apr 28.
55 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
56 NO(2) functionalized coumarin derivatives suppress cancer progression and facilitate apoptotic cell death in KRAS mutant colon cancer. Chem Biol Interact. 2019 Aug 25;309:108708. doi: 10.1016/j.cbi.2019.06.021. Epub 2019 Jun 11.
57 Probiotic Bacillus subtilis CW14 reduces disruption of the epithelial barrier and toxicity of ochratoxin A to Caco-2?cells. Food Chem Toxicol. 2019 Apr;126:25-33. doi: 10.1016/j.fct.2019.02.009. Epub 2019 Feb 11.
58 CD34+ derived macrophage and dendritic cells display differential responses to paraquat. Toxicol In Vitro. 2021 Sep;75:105198. doi: 10.1016/j.tiv.2021.105198. Epub 2021 Jun 9.
59 p53 activation by Ni(II) is a HIF-1 independent response causing caspases 9/3-mediated apoptosis in human lung cells. Toxicol Appl Pharmacol. 2013 Jun 15;269(3):233-9. doi: 10.1016/j.taap.2013.03.023. Epub 2013 Apr 6.
60 Kaempferol induces apoptosis in human HCT116 colon cancer cells via the Ataxia-Telangiectasia Mutated-p53 pathway with the involvement of p53 Upregulated Modulator of Apoptosis. Chem Biol Interact. 2009 Jan 27;177(2):121-7. doi: 10.1016/j.cbi.2008.10.048. Epub 2008 Nov 5.
61 Licochalcone A from licorice root, an inhibitor of human hepatoma cell growth via induction of cell apoptosis and cell cycle arrest. Food Chem Toxicol. 2018 Oct;120:407-417. doi: 10.1016/j.fct.2018.07.044. Epub 2018 Jul 25.
62 Facilitation of 9,10-phenanthrenequinone-elicited neuroblastoma cell apoptosis by NAD(P)H:quinone oxidoreductase 1. Chem Biol Interact. 2018 Jan 5;279:10-20.
63 Cannabinoid CP55940 selectively induces apoptosis in Jurkat cells and in ex vivo T-cell acute lymphoblastic leukemia through H(2)O(2) signaling mechanism. Leuk Res. 2020 Aug;95:106389. doi: 10.1016/j.leukres.2020.106389. Epub 2020 May 26.
64 Statin-induced Mitochondrial Priming Sensitizes Multiple Myeloma Cells to BCL2 and MCL-1 Inhibitors. Cancer Res Commun. 2023 Dec 8;3(12):2497-2509. doi: 10.1158/2767-9764.CRC-23-0350.