Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTV0SYMD)

DOT Name	Basic salivary proline-rich protein 1 (PRB1)
Synonyms	Salivary proline-rich protein
Gene Name	PRB1
Related Disease	Acute leukaemia ( ) Acute megakaryoblastic leukemia ( ) Alzheimer disease ( ) Anemia ( ) Arrhythmogenic right ventricular cardiomyopathy ( ) Carcinoma ( ) Endometrial carcinoma ( ) Endometrium adenocarcinoma ( ) Essential thrombocythemia ( ) G6PD deficiency ( ) Hereditary nonpolyposis colon cancer ( ) Hypertrophic cardiomyopathy ( ) Multiple sclerosis ( ) Myelodysplastic syndrome ( ) Myelofibrosis ( ) Myeloproliferative neoplasm ( ) Neoplasm ( ) Obesity ( ) Obstructive sleep apnea ( ) Pancytopenia ( ) Plasma cell myeloma ( ) Polyp ( ) Primary myelofibrosis ( ) Retinoblastoma ( ) Seasonal affective disorder ( ) Tendinitis ( ) Thrombocytosis disease ( ) Pancreatic cancer ( ) Polycythemia vera ( ) Neuroblastoma ( )
UniProt ID	PRP1_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF15240
Sequence	MLLILLSVALLALSSAQNLNEDVSQEESPSLIAGNPQGPSPQGGNKPQGPPPPPGKPQGP PPQGGNKPQGPPPPGKPQGPPPQGDKSRSPRSPPGKPQGPPPQGGNQPQGPPPPPGKPQG PPPQGGNKPQGPPPPGKPQGPPPQGDKSQSPRSPPGKPQGPPPQGGNQPQGPPPPPGKPQ GPPPQGGNKPQGPPPPGKPQGPPPQGDKSQSPRSPPGKPQGPPPQGGNQPQGPPPPPGKP QGPPQQGGNRPQGPPPPGKPQGPPPQGDKSRSPQSPPGKPQGPPPQGGNQPQGPPPPPGK PQGPPPQGGNKPQGPPPPGKPQGPPAQGGSKSQSARSPPGKPQGPPQQEGNNPQGPPPPA GGNPQQPQAPPAGQPQGPPRPPQGGRPSRPPQ
KEGG Pathway	Salivary secretion (hsa04970 )

Molecular Interaction Atlas (MIA) of This DOT

30 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Acute leukaemia	DISDQFDI	Strong	Biomarker	[1]
Acute megakaryoblastic leukemia	DIS0JX3M	Strong	Biomarker	[2]
Alzheimer disease	DISF8S70	Strong	Genetic Variation	[3]
Anemia	DISTVL0C	Strong	Biomarker	[4]
Arrhythmogenic right ventricular cardiomyopathy	DIS3V2BE	Strong	Genetic Variation	[5]
Carcinoma	DISH9F1N	Strong	Genetic Variation	[6]
Endometrial carcinoma	DISXR5CY	Strong	Altered Expression	[7]
Endometrium adenocarcinoma	DISY6744	Strong	Biomarker	[6]
Essential thrombocythemia	DISWWK11	Strong	Genetic Variation	[8]
G6PD deficiency	DISYF1GO	Strong	Biomarker	[9]
Hereditary nonpolyposis colon cancer	DISPA49R	Strong	Biomarker	[10]
Hypertrophic cardiomyopathy	DISQG2AI	Strong	Genetic Variation	[5]
Multiple sclerosis	DISB2WZI	Strong	Biomarker	[11]
Myelodysplastic syndrome	DISYHNUI	Strong	Biomarker	[4]
Myelofibrosis	DISIMP21	Strong	Genetic Variation	[12]
Myeloproliferative neoplasm	DIS5KAPA	Strong	Genetic Variation	[13]
Neoplasm	DISZKGEW	Strong	Biomarker	[14]
Obesity	DIS47Y1K	Strong	Biomarker	[15]
Obstructive sleep apnea	DIS0SVD1	Strong	Biomarker	[15]
Pancytopenia	DISVKEHV	Strong	Biomarker	[16]
Plasma cell myeloma	DIS0DFZ0	Strong	Altered Expression	[17]
Polyp	DISRSLYF	Strong	Altered Expression	[18]
Primary myelofibrosis	DIS6L0CN	Strong	Genetic Variation	[12]
Retinoblastoma	DISVPNPB	Strong	Biomarker	[19]
Seasonal affective disorder	DIS908VO	Strong	Biomarker	[20]
Tendinitis	DISS7ANY	Strong	Biomarker	[21]
Thrombocytosis disease	DISNG0P4	Strong	Biomarker	[22]
Pancreatic cancer	DISJC981	moderate	Genetic Variation	[23]
Polycythemia vera	DISB5FPO	moderate	Biomarker	[24]
Neuroblastoma	DISVZBI4	Limited	Biomarker	[25]
------------------------------------------------------------------------------------


⏷ Show the Full List of 30 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Propylthiouracil	DM6D7N8	Approved	Basic salivary proline-rich protein 1 (PRB1) affects the response to substance of Propylthiouracil.	[27]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Basic salivary proline-rich protein 1 (PRB1).	[26]
------------------------------------------------------------------------------------

References

1	Genomic characterization in triple-negative primary myelofibrosis and other myeloid neoplasms with bone marrow fibrosis.Ann Hematol. 2019 Oct;98(10):2319-2328. doi: 10.1007/s00277-019-03766-z. Epub 2019 Aug 8.
2	Molecular pathways: induction of polyploidy as a novel differentiation therapy for leukemia.Clin Cancer Res. 2013 Nov 15;19(22):6084-8. doi: 10.1158/1078-0432.CCR-12-2604. Epub 2013 Aug 20.
3	Inheritance pattern of platelet membrane fluidity in Alzheimer disease.Am J Hum Genet. 1989 Jun;44(6):799-805.
4	Luspatercept for the treatment of anemia in myelodysplastic syndromes and primary myelofibrosis.Blood. 2019 Feb 21;133(8):790-794. doi: 10.1182/blood-2018-11-876888. Epub 2019 Jan 2.
5	Primary Myocardial Fibrosis as an Alternative Phenotype Pathway of Inherited Cardiac Structural Disorders.Circulation. 2018 Jun 19;137(25):2716-2726. doi: 10.1161/CIRCULATIONAHA.117.032175.
6	Clinicoprognostic significance of pRb1 pathway alterations in uterine endometrial adenocarcinoma.Cancer Genet Cytogenet. 2004 Oct 15;154(2):186-9. doi: 10.1016/j.cancergencyto.2004.05.016.
7	Allelic loss at TP53 is not related to p53 protein overexpression in primary human endometrial carcinomas.Oncology. 2005;69(4):317-25. doi: 10.1159/000089764. Epub 2005 Nov 17.
8	Clinical and molecular features of patients with prefibrotic primary myelofibrosis previously diagnosed as having essential thrombocythemia in Japan.Eur J Haematol. 2019 Jun;102(6):516-520. doi: 10.1111/ejh.13236. Epub 2019 Apr 25.
9	Prevalence of G6PD deficiency in selected populations from two previously high malaria endemic areas of Sri Lanka.PLoS One. 2017 Feb 2;12(2):e0171208. doi: 10.1371/journal.pone.0171208. eCollection 2017.
10	Mutations of two PMS homologues in hereditary nonpolyposis colon cancer.Nature. 1994 Sep 1;371(6492):75-80. doi: 10.1038/371075a0.
11	Multiparameter MRI quantification of microstructural tissue alterations in multiple sclerosis.Neuroimage Clin. 2019;23:101879. doi: 10.1016/j.nicl.2019.101879. Epub 2019 May 29.
12	Higher AURKA and PLK1 expression are associated with inferior overall survival in patients with myelofibrosis.Blood Cells Mol Dis. 2020 Mar;81:102396. doi: 10.1016/j.bcmd.2019.102396. Epub 2019 Dec 5.
13	Calreticulin Mutations in Bulgarian MPN Patients.Pathol Oncol Res. 2018 Jan;24(1):171-174. doi: 10.1007/s12253-017-0226-2. Epub 2017 Apr 14.
14	Tumor suppressors: enhancers or suppressors of regeneration?.Development. 2013 Jun;140(12):2502-12. doi: 10.1242/dev.084210.
15	Long-term follow-up of the German post-market study for upper airway stimulation for obstructive sleep apnea.Sleep Breath. 2020 Sep;24(3):979-984. doi: 10.1007/s11325-019-01933-0. Epub 2019 Sep 4.
16	VPS 45-associated primary infantile myelofibrosis--successful treatment with hematopoietic stem cell transplantation.Pediatr Transplant. 2013 Dec;17(8):820-5. doi: 10.1111/petr.12169.
17	Effects of epigenetic-based anti-cancer drugs in leukaemia and multiple myeloma cells.Cell Biol Int. 2011 Dec;35(12):1195-203. doi: 10.1042/CBI20100820.
18	Vacuolar hydrolysis and efflux: current knowledge and unanswered questions.Autophagy. 2019 Feb;15(2):212-227. doi: 10.1080/15548627.2018.1545821. Epub 2018 Nov 22.
19	Enterocyte differentiation is compatible with SV40 large T expression and loss of p53 function in human colonic Caco-2 cells. Status of the pRb1 and pRb2 tumor suppressor gene products.FEBS Lett. 1997 Apr 14;406(3):234-42. doi: 10.1016/s0014-5793(97)00208-1.
20	The Trajectory from Mood to Obesity.Curr Obes Rep. 2018 Mar;7(1):1-5. doi: 10.1007/s13679-017-0291-6.
21	Long-term local PDGF delivery using porous microspheres modified with heparin for tendon healing of rotator cuff tendinitis in a rabbit model.Carbohydr Polym. 2019 Apr 1;209:372-381. doi: 10.1016/j.carbpol.2019.01.017. Epub 2019 Jan 7.
22	Prefibrotic myelofibrosis: treatment algorithm 2018.Blood Cancer J. 2018 Nov 7;8(11):104. doi: 10.1038/s41408-018-0142-z.
23	Genetic polymorphisms associated with pancreatic cancer survival: a genome-wide association study.Int J Cancer. 2017 Aug 15;141(4):678-686. doi: 10.1002/ijc.30762. Epub 2017 May 15.
24	Whole blood transcriptional profiling reveals deregulation of oxidative and antioxidative defence genes in myelofibrosis and related neoplasms. Potential implications of downregulation of Nrf2 for genomic instability and disease progression.PLoS One. 2014 Nov 14;9(11):e112786. doi: 10.1371/journal.pone.0112786. eCollection 2014.
25	Assessing LINE-1 retrotransposition activity in neuroblastoma cells exposed to extremely low-frequency pulsed magnetic fields.Mutat Res. 2012 Dec 12;749(1-2):76-81. doi: 10.1016/j.mrgentox.2012.07.004. Epub 2012 Sep 7.
26	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
27	Responsiveness to 6-n-propylthiouracil (PROP) is associated with salivary levels of two specific basic proline-rich proteins in humans. PLoS One. 2012;7(2):e30962. doi: 10.1371/journal.pone.0030962. Epub 2012 Feb 1.