Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTV1PVAX)

• DOT Name: Phosphoserine phosphatase (PSPH)
• Synonyms: PSP; PSPase; EC 3.1.3.3; L-3-phosphoserine phosphatase; O-phosphoserine phosphohydrolase
• Gene Name: PSPH
• Related Disease:
  Attention deficit hyperactivity disorder
  Neu-Laxova syndrome 1
  PSPH deficiency
  Schizophrenia
  Wolfram syndrome
  Advanced cancer
  Autonomic nervous system disorder
  Bipolar disorder
  Colorectal carcinoma
  Corticobasal degeneration
  Dementia
  Depression
  Dysautonomia
  Ewing sarcoma
  Familial spontaneous pneumothorax
  Fanconi anemia complementation group A
  Fanconi's anemia
  Frontotemporal dementia
  Late-onset Parkinson disease
  Lung cancer
  Lung carcinoma
  Matthew-Wood syndrome
  Myotonic dystrophy
  Neoplasm
  Non-small-cell lung cancer
  Obstructive sleep apnea
  Parkinson disease
  Pick disease
  Pneumothorax
  Primary progressive aphasia
  Progressive supranuclear palsy
  Prostate adenocarcinoma
  Sjogren syndrome
  Tauopathy
  Type-1/2 diabetes
  Maternal phenylketonuria
  Neurometabolic disorder due to serine deficiency
  Non-alcoholic steatohepatitis
  Anxiety
  Anxiety disorder
  Adenocarcinoma
  Gastric cancer
  Inborn disorder of amino acid metabolism
  Lewy body dementia
  Nervous system disease
  Nutritional disorder
  Prostate cancer
  Prostate carcinoma
  Stomach cancer
• UniProt ID: SERB_HUMAN
• PDB ID: 1L8L; 1L8O; 1NNL; 6HYJ; 6HYY; 6Q6J
• EC Number: 3.1.3.3
• Pfam ID: PF00702
• Sequence:
  MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKA
  ALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVA
  SKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDG
  ATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE
• Function: Catalyzes the last irreversible step in the biosynthesis of L-serine from carbohydrates, the dephosphorylation of O-phospho-L-serine to L-serine. L-serine can then be used in protein synthesis, to produce other amino acids, in nucleotide metabolism or in glutathione synthesis, or can be racemized to D-serine, a neuromodulator. May also act on O-phospho-D-serine (Probable).
• KEGG Pathway:
  Glycine, serine and threonine metabolism (hsa00260)
  Metabolic pathways (hsa01100)
  Carbon metabolism (hsa01200)
  Biosynthesis of amino acids (hsa01230)
• Reactome Pathway: Serine biosynthesis (R-HSA-977347)
• BioCyc Pathway: MetaCyc:HS07370-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

49 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Attention deficit hyperactivity disorder	DISL8MX9	Definitive	Biomarker	[1]
Neu-Laxova syndrome 1	DISM00VW	Definitive	Autosomal recessive	[2]
PSPH deficiency	DISD3IJD	Definitive	Autosomal recessive	[3]
Schizophrenia	DISSRV2N	Definitive	Altered Expression	[1]
Wolfram syndrome	DISN16XW	Definitive	Altered Expression	[4]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[5]
Autonomic nervous system disorder	DIS6JLTA	Strong	Biomarker	[6]
Bipolar disorder	DISAM7J2	Strong	Biomarker	[7]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[8]
Corticobasal degeneration	DISSMOTT	Strong	Biomarker	[9]
Dementia	DISXL1WY	Strong	Biomarker	[10]
Depression	DIS3XJ69	Strong	Biomarker	[7]
Dysautonomia	DISF4MT6	Strong	Biomarker	[6]
Ewing sarcoma	DISQYLV3	Strong	Biomarker	[11]
Familial spontaneous pneumothorax	DISNM7SU	Strong	Biomarker	[12]
Fanconi anemia complementation group A	DIS8PZLI	Strong	Altered Expression	[13]
Fanconi's anemia	DISGW6Q8	Strong	Altered Expression	[13]
Frontotemporal dementia	DISKYHXL	Strong	Biomarker	[14]
Late-onset Parkinson disease	DIS9IOUI	Strong	Biomarker	[15]
Lung cancer	DISCM4YA	Strong	Biomarker	[16]
Lung carcinoma	DISTR26C	Strong	Biomarker	[16]
Matthew-Wood syndrome	DISA7HR7	Strong	Genetic Variation	[17]
Myotonic dystrophy	DISNBEMX	Strong	Biomarker	[6]
Neoplasm	DISZKGEW	Strong	Biomarker	[18]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[19]
Obstructive sleep apnea	DIS0SVD1	Strong	Altered Expression	[20]
Parkinson disease	DISQVHKL	Strong	Genetic Variation	[21]
Pick disease	DISP6X50	Strong	Genetic Variation	[22]
Pneumothorax	DISP86H1	Strong	Genetic Variation	[23]
Primary progressive aphasia	DISLRYFE	Strong	Biomarker	[24]
Progressive supranuclear palsy	DISO5KRQ	Strong	Biomarker	[25]
Prostate adenocarcinoma	DISBZYU8	Strong	Genetic Variation	[26]
Sjogren syndrome	DISUBX7H	Strong	Biomarker	[27]
Tauopathy	DISY2IPA	Strong	Genetic Variation	[22]
Type-1/2 diabetes	DISIUHAP	Strong	Altered Expression	[4]
Maternal phenylketonuria	DISAVNUV	moderate	Biomarker	[28]
Neurometabolic disorder due to serine deficiency	DISCF5UM	Moderate	Autosomal recessive	[29]
Non-alcoholic steatohepatitis	DIST4788	moderate	Biomarker	[30]
Anxiety	DISIJDBA	Disputed	Biomarker	[31]
Anxiety disorder	DISBI2BT	Disputed	Biomarker	[31]
Adenocarcinoma	DIS3IHTY	Limited	Biomarker	[32]
Gastric cancer	DISXGOUK	Limited	Biomarker	[32]
Inborn disorder of amino acid metabolism	DISFWXCM	Limited	Biomarker	[3]
Lewy body dementia	DISAE66J	Limited	Biomarker	[33]
Nervous system disease	DISJ7GGT	Limited	Biomarker	[25]
Nutritional disorder	DIS0W6QK	Limited	Biomarker	[34]
Prostate cancer	DISF190Y	Limited	Biomarker	[35]
Prostate carcinoma	DISMJPLE	Limited	Biomarker	[35]
Stomach cancer	DISKIJSX	Limited	Biomarker	[32]

22 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Phosphoserine phosphatase (PSPH).	[36]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Phosphoserine phosphatase (PSPH).	[37]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Phosphoserine phosphatase (PSPH).	[38]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Phosphoserine phosphatase (PSPH).	[39]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Phosphoserine phosphatase (PSPH).	[40]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Phosphoserine phosphatase (PSPH).	[41]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Phosphoserine phosphatase (PSPH).	[42]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Phosphoserine phosphatase (PSPH).	[43]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Phosphoserine phosphatase (PSPH).	[44]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Phosphoserine phosphatase (PSPH).	[45]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Phosphoserine phosphatase (PSPH).	[46]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Phosphoserine phosphatase (PSPH).	[47]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Phosphoserine phosphatase (PSPH).	[46]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol increases the expression of Phosphoserine phosphatase (PSPH).	[48]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of Phosphoserine phosphatase (PSPH).	[49]
Indomethacin	DMSC4A7	Approved	Indomethacin increases the expression of Phosphoserine phosphatase (PSPH).	[50]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol decreases the expression of Phosphoserine phosphatase (PSPH).	[51]
Genistein	DM0JETC	Phase 2/3	Genistein affects the expression of Phosphoserine phosphatase (PSPH).	[52]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Phosphoserine phosphatase (PSPH).	[53]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Phosphoserine phosphatase (PSPH).	[54]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Phosphoserine phosphatase (PSPH).	[55]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the expression of Phosphoserine phosphatase (PSPH).	[56]

References

• [1] Cognitive and behavioral precursors of schizophrenia.Dev Psychopathol. 1999 Summer;11(3):487-508. doi: 10.1017/s0954579499002175.
• [2] Neu-Laxova syndrome is a heterogeneous metabolic disorder caused by defects in enzymes of the L-serine biosynthesis pathway. Am J Hum Genet. 2014 Sep 4;95(3):285-93. doi: 10.1016/j.ajhg.2014.07.012. Epub 2014 Aug 21.
• [3] Mutations responsible for 3-phosphoserine phosphatase deficiency. Eur J Hum Genet. 2004 Feb;12(2):163-6. doi: 10.1038/sj.ejhg.5201083.
• [4] Pancreatic stone protein/regenerating protein is a potential biomarker for endoplasmic reticulum stress in beta cells.Sci Rep. 2019 Mar 26;9(1):5199. doi: 10.1038/s41598-019-41604-4.
• [5] Analyzing the capability of PSP, PCT and sCD25 to support the diagnosis of infection in cancer patients with febrile neutropenia.Clin Chem Lab Med. 2019 Mar 26;57(4):540-548. doi: 10.1515/cclm-2018-0154.
• [6] Coexistence of Progressive Supranuclear Palsy With Pontocerebellar Atrophy and Myotonic Dystrophy Type 1.J Neuropathol Exp Neurol. 2019 Aug 1;78(8):756-762. doi: 10.1093/jnen/nlz048.
• [7] Self-Reported Graphic Personal and Social Performance Scale (SRG-PSP) for measuring functionality in patients with bipolar disorder.J Affect Disord. 2017 Jun;215:256-262. doi: 10.1016/j.jad.2017.02.018. Epub 2017 Feb 20.
• [8] Phosphoserine Phosphatase Is a Novel Prognostic Biomarker on Chromosome 7 in Colorectal Cancer.Anticancer Res. 2017 May;37(5):2365-2371. doi: 10.21873/anticanres.11574.
• [9] Side effects induced by the acute levodopa challenge in Parkinson's Disease and atypical parkinsonisms.PLoS One. 2017 Feb 16;12(2):e0172145. doi: 10.1371/journal.pone.0172145. eCollection 2017.
• [10] Parkinson's syndrome associated with neurofibrillary degeneration and tau pathologic findings.Mov Disord. 2003 Sep;18 Suppl 6:S28-33. doi: 10.1002/mds.10560.
• [11] Menin regulates the serine biosynthetic pathway in Ewing sarcoma.J Pathol. 2018 Jul;245(3):324-336. doi: 10.1002/path.5085. Epub 2018 May 28.
• [12] A novel dual-covering method in video-assisted thoracic surgery for pediatric primary spontaneous pneumothorax.Surg Today. 2019 Jul;49(7):587-592. doi: 10.1007/s00595-019-01785-x. Epub 2019 Apr 6.
• [13] Identification of a novel c-DNA overexpressed in Fanconi's anemia fibroblasts partially homologous to a putative L-3-phosphoserine-phosphatase.Gene. 1998 Apr 14;210(2):297-306. doi: 10.1016/s0378-1119(98)00083-3.
• [14] Cerebellar atrophy in neurodegeneration-a meta-analysis.J Neurol Neurosurg Psychiatry. 2017 Sep;88(9):780-788. doi: 10.1136/jnnp-2017-315607. Epub 2017 May 13.
• [15] Manual MRI morphometry in Parkinsonian syndromes.Mov Disord. 2017 May;32(5):778-782. doi: 10.1002/mds.26921. Epub 2017 Feb 2.
• [16] Phosphoserine Phosphatase Promotes Lung Cancer Progression through the Dephosphorylation of IRS-1 and a Noncanonical L-Serine-Independent Pathway.Mol Cells. 2019 Aug 31;42(8):604-616. doi: 10.14348/molcells.2019.0160.
• [17] Human pancreatic cancer contains a side population expressing cancer stem cell-associated and prognostic genes.PLoS One. 2013 Sep 17;8(9):e73968. doi: 10.1371/journal.pone.0073968. eCollection 2013.
• [18] Race-associated biological differences among Luminal A breast tumors.Breast Cancer Res Treat. 2015 Jul;152(2):437-48. doi: 10.1007/s10549-015-3474-4. Epub 2015 Jun 25.
• [19] Upregulation of phosphoserine phosphatase contributes to tumor progression and predicts poor prognosis in non-small cell lung cancer patients.Thorac Cancer. 2019 May;10(5):1203-1212. doi: 10.1111/1759-7714.13064. Epub 2019 Apr 11.
• [20] Transcriptomic analysis identifies phosphatases as novel targets for adenotonsillar hypertrophy of pediatric obstructive sleep apnea.Am J Respir Crit Care Med. 2010 May 15;181(10):1114-20. doi: 10.1164/rccm.200909-1398OC. Epub 2010 Jan 21.
• [21] The genetic and clinico-pathological profile of early-onset progressive supranuclear palsy.Mov Disord. 2019 Sep;34(9):1307-1314. doi: 10.1002/mds.27786. Epub 2019 Jul 12.
• [22] Involvement of Oligodendrocytes in Tau Seeding and Spreading in Tauopathies.Front Aging Neurosci. 2019 May 28;11:112. doi: 10.3389/fnagi.2019.00112. eCollection 2019.
• [23] Primary and Secondary Spontaneous Pneumothorax: Prevalence, Clinical Features, and In-Hospital Mortality.Can Respir J. 2017;2017:6014967. doi: 10.1155/2017/6014967. Epub 2017 Mar 13.
• [24] C9ORF72 repeat expansions in the frontotemporal dementias spectrum of diseases: a flow-chart for genetic testing.J Alzheimers Dis. 2013;34(2):485-99. doi: 10.3233/JAD-121456.
• [25] Sensitivity and Specificity of Diagnostic Criteria for Progressive Supranuclear Palsy.Mov Disord. 2019 Aug;34(8):1144-1153. doi: 10.1002/mds.27619. Epub 2019 Feb 6.
• [26] A novel knock-in prostate cancer model demonstrates biology similar to that of human prostate cancer and suitable for preclinical studies.Mol Ther. 2005 Mar;11(3):348-62. doi: 10.1016/j.ymthe.2004.12.005.
• [27] Novel Sjgren's autoantibodies found in fibromyalgia patients with sicca and/or xerostomia.Autoimmun Rev. 2019 Feb;18(2):199-202. doi: 10.1016/j.autrev.2018.09.004. Epub 2018 Dec 18.
• [28] The effects of hyperphenylalaninemia on fetal development: a new animal model of maternal phenylketonuria.Pediatr Res. 1982 May;16(5):388-94. doi: 10.1203/00006450-198205000-00014.
• [29] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [30] Genome-scale metabolic modelling of hepatocytes reveals serine deficiency in patients with non-alcoholic fatty liver disease.Nat Commun. 2014;5:3083. doi: 10.1038/ncomms4083.
• [31] Psychological factors predict an unfavorable pain trajectory after hysterectomy: a prospective cohort study on chronic postsurgical pain.Pain. 2018 May;159(5):956-967. doi: 10.1097/j.pain.0000000000001170.
• [32] Combination of L-3-phosphoserine phosphatase and CEA using real-time RT-PCR improves accuracy in detection of peritoneal micrometastasis of gastric cancer.Anticancer Res. 2004 Mar-Apr;24(2C):1113-20.
• [33] Non-Alzheimer's disease dementias: anatomic, clinical, and molecular correlates.Can J Psychiatry. 2004 Mar;49(3):164-71. doi: 10.1177/070674370404900303.
• [34] Radiolucent and calcified pancreatic lithiasis: two different diseases. Role of alcohol and heredity.Scand J Gastroenterol. 1992;27(1):71-6. doi: 10.3109/00365529209011170.
• [35] Comparison of prostate-specific promoters and the use of PSP-driven virotherapy for prostate cancer.Biomed Res Int. 2013;2013:624632. doi: 10.1155/2013/624632. Epub 2013 Jan 31.
• [36] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [37] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [38] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [39] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [40] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [41] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [42] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [43] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [44] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [45] Endoplasmic reticulum stress contributes to arsenic trioxide-induced intrinsic apoptosis in human umbilical and bone marrow mesenchymal stem cells. Environ Toxicol. 2016 Mar;31(3):314-28.
• [46] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [47] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [48] Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
• [49] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [50] Anti-inflammatory agent indomethacin reduces invasion and alters metabolism in a human breast cancer cell line. Neoplasia. 2007 Mar;9(3):222-35.
• [51] The genomic response of a human uterine endometrial adenocarcinoma cell line to 17alpha-ethynyl estradiol. Toxicol Sci. 2009 Jan;107(1):40-55.
• [52] Dose- and time-dependent transcriptional response of Ishikawa cells exposed to genistein. Toxicol Sci. 2016 May;151(1):71-87.
• [53] New insights into BaP-induced toxicity: role of major metabolites in transcriptomics and contribution to hepatocarcinogenesis. Arch Toxicol. 2016 Jun;90(6):1449-58.
• [54] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [55] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [56] The contact allergen nickel triggers a unique inflammatory and proangiogenic gene expression pattern via activation of NF-kappaB and hypoxia-inducible factor-1alpha. J Immunol. 2007 Mar 1;178(5):3198-207.