General Information of Drug Off-Target (DOT) (ID: OTV6I4Z0)

DOT Name Transmembrane protein 132D (TMEM132D)
Synonyms Mature oligodendrocytes transmembrane protein; Mature OL transmembrane protein
Gene Name TMEM132D
Related Disease
Acute myelogenous leukaemia ( )
Breast cancer ( )
Breast carcinoma ( )
Colon cancer ( )
Colon carcinoma ( )
Kidney cancer ( )
Melanoma ( )
Non-small-cell lung cancer ( )
Renal carcinoma ( )
T-cell leukaemia ( )
Acute leukaemia ( )
Acute lymphocytic leukaemia ( )
Acute monocytic leukemia ( )
Acute myelomonocytic leukemia M4 ( )
Advanced cancer ( )
Anxiety ( )
B-cell neoplasm ( )
Bruton-type agammaglobulinemia ( )
Carcinoma ( )
Childhood acute lymphoblastic leukemia ( )
leukaemia ( )
Leukemia ( )
Liver cancer ( )
Lymphoid leukemia ( )
Major depressive disorder ( )
Mental disorder ( )
Neoplasm ( )
Neuroblastoma ( )
Panic disorder ( )
Precancerous condition ( )
Schizophrenia ( )
Sjogren syndrome ( )
T-cell acute lymphoblastic leukaemia ( )
T-cell lymphoma ( )
Anxiety disorder ( )
Small lymphocytic lymphoma ( )
Burkitt lymphoma ( )
Intellectual disability ( )
Small-cell lung cancer ( )
UniProt ID
T132D_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF16070 ; PF15706 ; PF15705
Sequence
MCPSEMGTLWHHWSPVLISLAALFSKVTEGRGILESIQRFSLLPTYLPVTYHINNADVSF
FLKEANQDIMRNSSLQSRVESFLIYKSRRLPVLNASYGPFSIEQVVPQDLMLPSNPFGFT
NKFSLNWKLKAHILRDKVYLSRPKVQVLFHIMGRDWDDRSAGEKLPCLRVFAFRETREVR
GSCRLQGDLGLCVAELELLSSWFSPPTVVAGRRKSVDQPEGTPVELYYTVHPGGERGDCV
REDARRSNGIRTGHSDIDESGPPLQRIGSIFLYQTHRKPSLRELRLDNSVAIHYIPKTVR
KGDVLTFPVSISRNSTEDRFTLRAKVKKGVNIIGVRASSPSIWDVKERTDYTGKYAPAVI
VCQKKAAGSENSADGASYEVMQIDVEVEEPGDLPATQLVTWQVEYPGEITSDLGVSKIYV
SPKDLIGVVPLAMEAEILNTAILTGKTVAVPVKVVSVEDDGTVTELLESVECRSSDEDVI
KVSDRCDYVFVNGKEMKGKVNVVVNFTYQHLSSPLEMTVWVPRLPLQIEVSDTELNQIKG
WRVPIVSSRRPAGDSEEEEDDERRGRGCTLQYQHAMVRVLTQFVAEAAGPGGHLAHLLGS
DWQVDITELINDFMQVEEPRIAKLQGGQILMGQELGMTTIQILSPLSDTILAEKTITVLD
EKVTITDLGVQLVTGLSLSLQLSPGSNRAIFATAVAQELLQRPKQEAAISCWVQFSDGSV
TPLDIYDGKDFSLMATSLDEKVVSIHQDPKFKWPIIAAETEGQGTLVKVEMVISESCQKS
KRKSVLAVGTANIKVKFGQNDANPNTSDSRHTGAGVHMENNVSDRRPKKPSQEWGSQEGQ
YYGSSSMGLMEGRGTTTDRSILQKKKGQESLLDDNSHLQTIPSDLTSFPAQVDLPRSNGE
MDGNDLMQASKGLSDLEIGMYALLGVFCLAILVFLINCVTFALKYRHKQVPFEEQEGMSH
SHDWVGLSNRTELLENHINFASSQDEQITAIDRGMDFEESKYLLSTNSQKSINGQLFKPL
GPIIIDGKDQKSEPPTSPTSKRKRVKFTTFTAVSSDDEYPTRNSIVMSSEDDIKWVCQDL
DPGDCKELHNYMERLHENV
Function Regulate neuronals morphology via inhibition of the WAVE regulatory complex (WCR), a complex that controls F-actin cytoskeletal dynamics.
Tissue Specificity Expressed in mature oligodendrocytes. Detected in the brain, lung, pancreas and testis . Highly expressed in mature neurons of the adult nervous system .

Molecular Interaction Atlas (MIA) of This DOT

39 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Acute myelogenous leukaemia DISCSPTN Definitive Genetic Variation [1]
Breast cancer DIS7DPX1 Definitive Genetic Variation [2]
Breast carcinoma DIS2UE88 Definitive Genetic Variation [2]
Colon cancer DISVC52G Definitive Biomarker [2]
Colon carcinoma DISJYKUO Definitive Biomarker [2]
Kidney cancer DISBIPKM Definitive Biomarker [2]
Melanoma DIS1RRCY Definitive Biomarker [2]
Non-small-cell lung cancer DIS5Y6R9 Definitive Biomarker [2]
Renal carcinoma DISER9XT Definitive Biomarker [2]
T-cell leukaemia DISJ6YIF Definitive Altered Expression [3]
Acute leukaemia DISDQFDI Strong Genetic Variation [4]
Acute lymphocytic leukaemia DISPX75S Strong Biomarker [5]
Acute monocytic leukemia DIS28NEL Strong Biomarker [6]
Acute myelomonocytic leukemia M4 DISRRMV2 Strong Biomarker [6]
Advanced cancer DISAT1Z9 Strong Biomarker [7]
Anxiety DISIJDBA Strong Biomarker [8]
B-cell neoplasm DISVY326 Strong Biomarker [9]
Bruton-type agammaglobulinemia DISQ5ZYP Strong Biomarker [10]
Carcinoma DISH9F1N Strong Biomarker [11]
Childhood acute lymphoblastic leukemia DISJ5D6U Strong Biomarker [12]
leukaemia DISS7D1V Strong Genetic Variation [13]
Leukemia DISNAKFL Strong Genetic Variation [13]
Liver cancer DISDE4BI Strong Biomarker [14]
Lymphoid leukemia DIS65TYQ Strong Biomarker [15]
Major depressive disorder DIS4CL3X Strong Genetic Variation [16]
Mental disorder DIS3J5R8 Strong Genetic Variation [17]
Neoplasm DISZKGEW Strong Biomarker [18]
Neuroblastoma DISVZBI4 Strong Genetic Variation [19]
Panic disorder DISD3VNY Strong Genetic Variation [8]
Precancerous condition DISV06FL Strong Biomarker [14]
Schizophrenia DISSRV2N Strong Genetic Variation [20]
Sjogren syndrome DISUBX7H Strong Genetic Variation [21]
T-cell acute lymphoblastic leukaemia DIS17AI2 Strong Biomarker [18]
T-cell lymphoma DISSXRTQ Strong Biomarker [22]
Anxiety disorder DISBI2BT moderate Biomarker [8]
Small lymphocytic lymphoma DIS30POX moderate Biomarker [23]
Burkitt lymphoma DIS9D5XU Limited Genetic Variation [24]
Intellectual disability DISMBNXP Limited Autosomal recessive [25]
Small-cell lung cancer DISK3LZD Limited Biomarker [26]
------------------------------------------------------------------------------------
⏷ Show the Full List of 39 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Transmembrane protein 132D (TMEM132D). [27]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Transmembrane protein 132D (TMEM132D). [30]
Bisphenol A DM2ZLD7 Investigative Bisphenol A affects the methylation of Transmembrane protein 132D (TMEM132D). [31]
------------------------------------------------------------------------------------
3 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Cisplatin DMRHGI9 Approved Cisplatin affects the expression of Transmembrane protein 132D (TMEM132D). [28]
Temozolomide DMKECZD Approved Temozolomide increases the expression of Transmembrane protein 132D (TMEM132D). [29]
Decitabine DMQL8XJ Approved Decitabine affects the expression of Transmembrane protein 132D (TMEM132D). [28]
------------------------------------------------------------------------------------

References

1 Genome-wide haplotype association study identify the FGFR2 gene as a risk gene for acute myeloid leukemia.Oncotarget. 2017 Jan 31;8(5):7891-7899. doi: 10.18632/oncotarget.13631.
2 Design, synthesis and evaluation of novel sulfonamides as potential anticancer agents.Comput Biol Chem. 2018 Jun;74:294-303. doi: 10.1016/j.compbiolchem.2018.04.006. Epub 2018 Apr 10.
3 SAR study of 5-alkynyl substituted quinazolin-4(3H)-ones as phosphoinositide 3-kinase delta (PI3K) inhibitors.Eur J Med Chem. 2017 Jan 5;125:1156-1171. doi: 10.1016/j.ejmech.2016.11.014. Epub 2016 Nov 9.
4 Expression of BRCA1 and BRCA2 in male breast cancers and gynecomastias.Anticancer Res. 2003 Jan-Feb;23(1B):661-7.
5 Time dependent response of daunorubicin on cytotoxicity, cell cycle and DNA repair in acute lymphoblastic leukaemia.BMC Cancer. 2019 Feb 27;19(1):179. doi: 10.1186/s12885-019-5377-y.
6 The cytotoxic potential of interleukin-15-stimulated cytokine-induced killer cells against leukemia cells.Cytotherapy. 2012 Jan;14(1):91-103. doi: 10.3109/14653249.2011.613931. Epub 2011 Oct 6.
7 Vernodalidimer L, a sesquiterpene lactone dimer from Vernonia extensa and anti-tumor effects of vernodalin, vernolepin, and vernolide on HepG2 liver cancer cells.Bioorg Chem. 2019 Nov;92:103197. doi: 10.1016/j.bioorg.2019.103197. Epub 2019 Aug 16.
8 Polymorphism in Tmem132d regulates expression and anxiety-related behavior through binding of RNA polymerase II complex.Transl Psychiatry. 2018 Jan 10;8(1):1. doi: 10.1038/s41398-017-0025-2.
9 A developed antibody-drug conjugate rituximab-vcMMAE shows a potent cytotoxic activity against CD20-positive cell line.Artif Cells Nanomed Biotechnol. 2018;46(sup2):1-8. doi: 10.1080/21691401.2018.1449119. Epub 2018 Mar 9.
10 Cellular origins of serum complement receptor type 2 in normal individuals and in hypogammaglobulinaemia.Clin Exp Immunol. 1991 Apr;84(1):16-22. doi: 10.1111/j.1365-2249.1991.tb08117.x.
11 Lack of rearranged Tpr-met mRNA expression in human gastric cancer cell lines and gastric mucosa and carcinoma.Anticancer Res. 1996 Sep-Oct;16(5A):2881-4.
12 Antiproliferative Effect of Gaillardin from Inula oculus-christi in Human Leukemic Cells.Nutr Cancer. 2020;72(6):1043-1056. doi: 10.1080/01635581.2019.1665188. Epub 2019 Sep 23.
13 Synthesis of New Derivatives of Benzofuran as Potential Anticancer Agents.Molecules. 2019 Apr 18;24(8):1529. doi: 10.3390/molecules24081529.
14 Multiple genes exhibit phenobarbital-induced constitutive active/androstane receptor-mediated DNA methylation changes during liver tumorigenesis and in liver tumors.Toxicol Sci. 2009 Apr;108(2):273-89. doi: 10.1093/toxsci/kfp031. Epub 2009 Feb 20.
15 Long Chain Alkyl Esters of Hydroxycinnamic Acids as Promising Anticancer Agents: Selective Induction of Apoptosis in Cancer Cells.J Agric Food Chem. 2017 Aug 23;65(33):7228-7239. doi: 10.1021/acs.jafc.7b01388. Epub 2017 Aug 8.
16 Association of TMEM132D, COMT, and GABRA6 genotypes with cingulate, frontal cortex and hippocampal emotional processing in panic and major depressive disorder.Int J Psychiatry Clin Pract. 2015;19(3):192-200. doi: 10.3109/13651501.2015.1043133. Epub 2015 May 14.
17 Genome-wide significant loci for addiction and anxiety.Eur Psychiatry. 2016 Aug;36:47-54. doi: 10.1016/j.eurpsy.2016.03.004. Epub 2016 Jun 16.
18 CD47 agonist peptide PKHB1 induces immunogenic cell death in T-cell acute lymphoblastic leukemia cells.Cancer Sci. 2019 Jan;110(1):256-268. doi: 10.1111/cas.13885. Epub 2018 Dec 14.
19 Platelet-activating factor activates HIV promoter in transfected SH-SY5Y neuroblastoma cells and MOLT-4 T lymphocytes.J Mol Neurosci. 1990;2(2):79-84. doi: 10.1007/BF02876914.
20 Genome-wide association study identifies five new schizophrenia loci.Nat Genet. 2011 Sep 18;43(10):969-76. doi: 10.1038/ng.940.
21 Initial human T-cell leukemia virus type 1 infection of the salivary gland epithelial cells requires a biofilm-like structure.Virus Res. 2019 Aug;269:197643. doi: 10.1016/j.virusres.2019.197643. Epub 2019 Jun 21.
22 Leptin and its receptor in glucose metabolism of T-cell lymphoma.Oncol Lett. 2018 Nov;16(5):5838-5846. doi: 10.3892/ol.2018.9356. Epub 2018 Aug 23.
23 A new disulfide-linked dimer of a single-chain antibody fragment against human CD47 induces apoptosis in lymphoid malignant cells via the hypoxia inducible factor-1 pathway.Cancer Sci. 2011 Jun;102(6):1208-15. doi: 10.1111/j.1349-7006.2011.01925.x. Epub 2011 May 3.
24 Biallelic deletion and loss of expression analysis of genes at FRA2G common fragile site in tumor-derived cell lines.Cancer Genet Cytogenet. 2005 Sep;161(2):181-6. doi: 10.1016/j.cancergencyto.2005.01.018.
25 Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
26 Expression and clinical significance of genes frequently mutated in small cell lung cancers defined by whole exome/RNA sequencing.Carcinogenesis. 2015 Jun;36(6):616-21. doi: 10.1093/carcin/bgv026. Epub 2015 Apr 11.
27 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
28 Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
29 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
30 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
31 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.