Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTYOLI12)

• DOT Name: Protein Niban 1 (NIBAN1)
• Synonyms: Cell growth-inhibiting gene 39 protein; Protein FAM129A
• Gene Name: NIBAN1
• Related Disease:
  Epithelial ovarian cancer
  Metastatic malignant neoplasm
  Neoplasm
  Ovarian cancer
  Ovarian neoplasm
  Pineoblastoma
  Prostate cancer
  Prostate carcinoma
  Thyroid gland follicular carcinoma
  Thyroid cancer
  Thyroid gland carcinoma
  Thyroid tumor
  Asthma
  Cholestasis
  Kidney neoplasm
• UniProt ID: NIBA1_HUMAN
• Sequence:
  MGGSASSQLDEGKCAYIRGKTEAAIKNFSPYYSRQYSVAFCNHVRTEVEQQRDLTSQFLK
  TKPPLAPGTILYEAELSQFSEDIKKWKERYVVVKNDYAVESYENKEAYQRGAAPKCRILP
  AGGKVLTSEDEYNLLSDRHFPDPLASSEKENTQPFVVLPKEFPVYLWQPFFRHGYFCFHE
  AADQKRFSALLSDCVRHLNHDYMKQMTFEAQAFLEAVQFFRQEKGHYGSWEMITGDEIQI
  LSNLVMEELLPTLQTDLLPKMKGKKNDRKRTWLGLLEEAYTLVQHQVSEGLSALKEECRA
  LTKGLEGTIRSDMDQIVNSKNYLIGKIKAMVAQPAEKSCLESVQPFLASILEELMGPVSS
  GFSEVRVLFEKEVNEVSQNFQTTKDSVQLKEHLDRLMNLPLHSVKMEPCYTKVNLLHERL
  QDLKSRFRFPHIDLVVQRTQNYMQELMENAVFTFEQLLSPHLQGEASKTAVAIEKVKLRV
  LKQYDYDSSTIRKKIFQEALVQITLPTVQKALASTCKPELQKYEQFIFADHTNMIHVENV
  YEEILHQILLDETLKVIKEAAILKKHNLFEDNMALPSESVSSLTDLKPPTGSNQASPARR
  ASAILPGVLGSETLSNEVFQESEEEKQPEVPSSLAKGESLSLPGPSPPPDGTEQVIISRV
  DDPVVNPVATEDTAGLPGTCSSELEFGGTLEDEEPAQEEPEPITASGSLKALRKLLTASV
  EVPVDSAPVMEEDTNGESHVPQENEEEEEKEPSQAAAIHPDNCEESEVSEREAQPPCPEA
  HGEELGGFPEVGSPASPPASGGLTEEPLGPMEGELPGEACTLTAHEGRGGKCTEEGDASQ
  QEGCTLGSDPICLSESQVSEEQEEMGGQSSAAQATASVNAEEIKVARIHECQWVVEDAPN
  PDVLLSHKDDVKEGEGGQESFPELPSEE
• Function: Regulates phosphorylation of a number of proteins involved in translation regulation including EIF2A, EIF4EBP1 and RPS6KB1. May be involved in the endoplasmic reticulum stress response.
• Tissue Specificity: Expressed in various types of thyroid tumor such as papillary thyroid carcinomas and oxyphilic thyroid tumors but not in normal thyroid tissue (at protein level). Strongly expressed in heart, skeletal muscle, pancreas, white blood cells and prostate with moderate expression in colon and spleen. Expressed in renal carcinoma cells but not in normal kidney.

Molecular Interaction Atlas (MIA) of This DOT

15 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[1]
Metastatic malignant neoplasm	DIS86UK6	Strong	Biomarker	[1]
Neoplasm	DISZKGEW	Strong	Biomarker	[2]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[1]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[1]
Pineoblastoma	DISQK8F3	Strong	Biomarker	[3]
Prostate cancer	DISF190Y	Strong	Biomarker	[2]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[2]
Thyroid gland follicular carcinoma	DISFK2QT	Strong	Biomarker	[4]
Thyroid cancer	DIS3VLDH	moderate	Altered Expression	[5]
Thyroid gland carcinoma	DISMNGZ0	moderate	Biomarker	[6]
Thyroid tumor	DISLVKMD	moderate	Altered Expression	[5]
Asthma	DISW9QNS	Disputed	Biomarker	[7]
Cholestasis	DISDJJWE	Limited	Biomarker	[8]
Kidney neoplasm	DISBNZTN	Limited	Altered Expression	[9]

This DOT Affected the Drug Response of 3 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Etoposide	DMNH3PG	Approved	Protein Niban 1 (NIBAN1) affects the response to substance of Etoposide.	[41]
Mitomycin	DMH0ZJE	Approved	Protein Niban 1 (NIBAN1) affects the response to substance of Mitomycin.	[41]
Topotecan	DMP6G8T	Approved	Protein Niban 1 (NIBAN1) affects the response to substance of Topotecan.	[41]

30 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Protein Niban 1 (NIBAN1).	[10]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Protein Niban 1 (NIBAN1).	[11]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Protein Niban 1 (NIBAN1).	[12]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Protein Niban 1 (NIBAN1).	[13]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Protein Niban 1 (NIBAN1).	[14]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Protein Niban 1 (NIBAN1).	[15]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Protein Niban 1 (NIBAN1).	[16]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Protein Niban 1 (NIBAN1).	[17]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Protein Niban 1 (NIBAN1).	[18]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Protein Niban 1 (NIBAN1).	[19]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Protein Niban 1 (NIBAN1).	[20]
Selenium	DM25CGV	Approved	Selenium decreases the expression of Protein Niban 1 (NIBAN1).	[21]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of Protein Niban 1 (NIBAN1).	[22]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of Protein Niban 1 (NIBAN1).	[23]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol decreases the expression of Protein Niban 1 (NIBAN1).	[24]
Ethanol	DMDRQZU	Approved	Ethanol increases the expression of Protein Niban 1 (NIBAN1).	[25]
Nicotine	DMWX5CO	Approved	Nicotine increases the expression of Protein Niban 1 (NIBAN1).	[26]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of Protein Niban 1 (NIBAN1).	[27]
Azacitidine	DMTA5OE	Approved	Azacitidine increases the expression of Protein Niban 1 (NIBAN1).	[28]
Lucanthone	DMZLBUO	Approved	Lucanthone decreases the expression of Protein Niban 1 (NIBAN1).	[29]
Bicalutamide	DMZMSPF	Approved	Bicalutamide increases the expression of Protein Niban 1 (NIBAN1).	[30]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Protein Niban 1 (NIBAN1).	[31]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Protein Niban 1 (NIBAN1).	[32]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of Protein Niban 1 (NIBAN1).	[33]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of Protein Niban 1 (NIBAN1).	[21]
Afimoxifene	DMFORDT	Phase 2	Afimoxifene increases the expression of Protein Niban 1 (NIBAN1).	[34]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Protein Niban 1 (NIBAN1).	[35]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Protein Niban 1 (NIBAN1).	[36]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Protein Niban 1 (NIBAN1).	[38]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Protein Niban 1 (NIBAN1).	[40]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Protein Niban 1 (NIBAN1).	[37]
Coumarin	DM0N8ZM	Investigative	Coumarin decreases the phosphorylation of Protein Niban 1 (NIBAN1).	[39]

References

• [1] The epigenetic factor BORIS (CTCFL) controls the androgen receptor regulatory network in ovarian cancer.Oncogenesis. 2019 Aug 12;8(8):41. doi: 10.1038/s41389-019-0150-2.
• [2] Regulation of the unfolded protein response through ATF4 and FAM129A in prostate cancer.Oncogene. 2019 Aug;38(35):6301-6318. doi: 10.1038/s41388-019-0879-2. Epub 2019 Jul 16.
• [3] Genome-wide molecular characterization of central nervous system primitive neuroectodermal tumor and pineoblastoma.Neuro Oncol. 2011 Aug;13(8):866-79. doi: 10.1093/neuonc/nor070.
• [4] A preoperative diagnostic test that distinguishes benign from malignant thyroid carcinoma based on gene expression.J Clin Invest. 2004 Apr;113(8):1234-42. doi: 10.1172/JCI19617.
• [5] microRNA-106b-mediated down-regulation of C1orf24 expression induces apoptosis and suppresses invasion of thyroid cancer.Oncotarget. 2015 Sep 29;6(29):28357-70. doi: 10.18632/oncotarget.4947.
• [6] FAM129A regulates autophagy in thyroid carcinomas in an oncogene-dependent manner.Endocr Relat Cancer. 2019 Jan 1;26(1):227-238. doi: 10.1530/ERC-17-0530.
• [7] Systems biology and invitro validation identifies family with sequence similarity 129 member A(FAM129A) as an asthma steroid response modulator.J Allergy Clin Immunol. 2018 Nov;142(5):1479-1488.e12. doi: 10.1016/j.jaci.2017.11.059. Epub 2018 Mar 2.
• [8] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [9] Niban gene is commonly expressed in the renal tumors: a new candidate marker for renal carcinogenesis.Oncogene. 2004 Apr 22;23(19):3495-500. doi: 10.1038/sj.onc.1207468.
• [10] The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
• [11] Inter-laboratory comparison of human renal proximal tubule (HK-2) transcriptome alterations due to Cyclosporine A exposure and medium exhaustion. Toxicol In Vitro. 2009 Apr;23(3):486-99.
• [12] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [13] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [14] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [15] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [16] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [17] Arsenic targets Pin1 and cooperates with retinoic acid to inhibit cancer-driving pathways and tumor-initiating cells. Nat Commun. 2018 Aug 9;9(1):3069. doi: 10.1038/s41467-018-05402-2.
• [18] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [19] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [20] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [21] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [22] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [23] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [24] Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
• [25] Gene expression signatures after ethanol exposure in differentiating embryoid bodies. Toxicol In Vitro. 2018 Feb;46:66-76.
• [26] Characterizing the genetic basis for nicotine induced cancer development: a transcriptome sequencing study. PLoS One. 2013 Jun 18;8(6):e67252.
• [27] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [28] Differential regulation of the p73 cistrome by mammalian target of rapamycin reveals transcriptional programs of mesenchymal differentiation and tumorigenesis. Proc Natl Acad Sci U S A. 2011 Feb 1;108(5):2076-81. doi: 10.1073/pnas.1011936108. Epub 2011 Jan 18.
• [29] Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
• [30] Microarray analysis of bicalutamide action on telomerase activity, p53 pathway and viability of prostate carcinoma cell lines. J Pharm Pharmacol. 2005 Jan;57(1):83-92.
• [31] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [32] Quantitative proteomics and transcriptomics addressing the estrogen receptor subtype-mediated effects in T47D breast cancer cells exposed to the phytoestrogen genistein. Mol Cell Proteomics. 2011 Jan;10(1):M110.002170.
• [33] Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
• [34] Gene expression preferentially regulated by tamoxifen in breast cancer cells and correlations with clinical outcome. Cancer Res. 2006 Jul 15;66(14):7334-40.
• [35] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [36] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [37] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [38] Cystathionine metabolic enzymes play a role in the inflammation resolution of human keratinocytes in response to sub-cytotoxic formaldehyde exposure. Toxicol Appl Pharmacol. 2016 Nov 1;310:185-194.
• [39] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [40] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
• [41] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.