Details of the Drug

General Information of Drug (ID: DMJ2O7B)

Drug Name
Gemtuzumab ozogamicin
Synonyms Mylotarg (TN)
Indication
Disease Entry ICD 11 Status REF
Acute myeloid leukaemia 2A60 Approved [1]
Therapeutic Class
Anticancer Agents
Drug Type
Antibody
Sequence
>light chain
DIQLTQSPSTLSASVGDRVTITCRASESLDNYGIRFLTWFQQKPGKAPKLLMYAASNQGS
GVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQTKEVPWSFGQGTKVEVKRTVAAPSVF
IFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLS
STLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
>heavy chain
EVQLVQSGAEVKKPGSSVKVSCKASGYTITDSNIHWVRQAPGQSLEWIGYIYPYNGGTDY
NQKFKNRATLTVDNPTNTAYMELSSLRSEDTAFYYCVNGNPWLAYWGQGTLVTVSSASTK
GPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYS
LSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFP
PKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVS
VLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVS
LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFS
CSVMHEALHNHYTQKSLSLSLGK
ADMET Property
Absorption AUC
The area under the plot of plasma concentration (AUC) of drug is 136 +/- 107 mgh/L [2]
Absorption Cmax
The maximum plasma concentration (Cmax) of drug is 3.47 +/- 1.04 mg/L [2]
Half-life
The concentration or amount of drug in body reduced by one-half in 64 +/- 44 hours [2]
Metabolism
The drug is metabolized via opsonization via the reticuloendothelial system []
Vd
The volume of distribution (Vd) of drug is 6.5 +/- 5.5 L [2]
Cross-matching ID
DrugBank ID
DB00056
TTD ID
D06EWO
VARIDT ID
DR00402
INTEDE ID
DR0767

Molecular Interaction Atlas of This Drug


Drug Therapeutic Target (DTT)
DTT Name DTT ID UniProt ID MOA REF
Myeloid cell surface antigen CD33 (CD33) TTJVYO3 CD33_HUMAN Not Available [3]

Drug-Metabolizing Enzyme (DME)
DME Name DME ID UniProt ID MOA REF
Cytochrome P450 3A4 (CYP3A4)
Main DME 		DE4LYSA CP3A4_HUMAN Substrate [4]
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This Drug

Molecular Expression Atlas of This Drug

The Studied Disease Acute myeloid leukaemia
ICD Disease Classification 2A60
Molecule Name Molecule Type Gene Name p-value Fold-Change Z-score
Myeloid cell surface antigen CD33 (CD33) DTT CD33 5.37E-13 0.58 1.13
Cytochrome P450 3A4 (CYP3A4) DME CYP3A4 7.29E-03 -3.47E-02 -1.80E-01
Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Same Disease as Gemtuzumab ozogamicin
DDI Drug Name DDI Drug ID Severity Mechanism Disease REF
Thioguanine DM7NKEV Moderate Increased risk of hepatotoxicity by the combination of Gemtuzumab ozogamicin and Thioguanine. Acute myeloid leukaemia [2A60] [5]
Coadministration of a Drug Treating the Disease Different from Gemtuzumab ozogamicin (Comorbidity)
DDI Drug Name DDI Drug ID Severity Mechanism Comorbidity REF
Remdesivir DMBFZ6L Moderate Increased risk of hepatotoxicity by the combination of Gemtuzumab ozogamicin and Remdesivir. 1D6YCoronavirus Disease 2019 [1D6YCoronavirus Disease 2019] [6]
Bedaquiline DM3906J Moderate Increased risk of hepatotoxicity by the combination of Gemtuzumab ozogamicin and Bedaquiline. Antimicrobial drug resistance [MG50-MG52] [7]
Roflumilast DMPGHY8 Moderate Additive immunosuppressive effects by the combination of Gemtuzumab ozogamicin and Roflumilast. Asthma [CA23] [8]
Ofloxacin DM0VQN3 Minor Decreased absorption of Gemtuzumab ozogamicin due to intestinal mucosa variation caused by Ofloxacin. Bacterial infection [1A00-1C4Z] [9]
Ciprofloxacin XR DM2NLS9 Minor Decreased absorption of Gemtuzumab ozogamicin due to intestinal mucosa variation caused by Ciprofloxacin XR. Bacterial infection [1A00-1C4Z] [9]
Trovafloxacin DM6AN32 Minor Decreased absorption of Gemtuzumab ozogamicin due to intestinal mucosa variation caused by Trovafloxacin. Bacterial infection [1A00-1C4Z] [9]
Sparfloxacin DMB4HCT Minor Decreased absorption of Gemtuzumab ozogamicin due to intestinal mucosa variation caused by Sparfloxacin. Bacterial infection [1A00-1C4Z] [9]
Gemifloxacin DMHT34O Minor Decreased absorption of Gemtuzumab ozogamicin due to intestinal mucosa variation caused by Gemifloxacin. Bacterial infection [1A00-1C4Z] [9]
Norfloxacin DMIZ6W2 Minor Decreased absorption of Gemtuzumab ozogamicin due to intestinal mucosa variation caused by Norfloxacin. Bacterial infection [1A00-1C4Z] [9]
ABT-492 DMJFD2I Minor Decreased absorption of Gemtuzumab ozogamicin due to intestinal mucosa variation caused by ABT-492. Bacterial infection [1A00-1C4Z] [9]
Levofloxacin DMS60RB Minor Decreased absorption of Gemtuzumab ozogamicin due to intestinal mucosa variation caused by Levofloxacin. Bacterial infection [1A00-1C4Z] [9]
Moxifloxacin DMU8V4S Minor Decreased absorption of Gemtuzumab ozogamicin due to intestinal mucosa variation caused by Moxifloxacin. Bacterial infection [1A00-1C4Z] [9]
Lomefloxacin DMVRH9C Minor Decreased absorption of Gemtuzumab ozogamicin due to intestinal mucosa variation caused by Lomefloxacin. Bacterial infection [1A00-1C4Z] [9]
Pexidartinib DMS2J0Z Major Increased risk of hepatotoxicity by the combination of Gemtuzumab ozogamicin and Pexidartinib. Bone/articular cartilage neoplasm [2F7B] [10]
Grepafloxacin DMGLX0T Minor Decreased absorption of Gemtuzumab ozogamicin due to intestinal mucosa variation caused by Grepafloxacin. Bronchitis [CA20] [9]
PMID27977313-Compound-29 DMIF7KG Moderate Increased risk of hepatotoxicity by the combination of Gemtuzumab ozogamicin and PMID27977313-Compound-29. Discovery agent [N.A.] [11]
Cannabidiol DM0659E Moderate Increased risk of hepatotoxicity by the combination of Gemtuzumab ozogamicin and Cannabidiol. Epileptic encephalopathy [8A62] [8]
Brentuximab vedotin DMWLC57 Moderate Increased risk of hepatotoxicity by the combination of Gemtuzumab ozogamicin and Brentuximab vedotin. Hodgkin lymphoma [2B30] [12]
Efavirenz DMC0GSJ Moderate Increased risk of hepatotoxicity by the combination of Gemtuzumab ozogamicin and Efavirenz. Human immunodeficiency virus disease [1C60-1C62] [13]
Mipomersen DMGSRN1 Major Increased risk of hepatotoxicity by the combination of Gemtuzumab ozogamicin and Mipomersen. Hyper-lipoproteinaemia [5C80] [14]
Teriflunomide DMQ2FKJ Major Increased risk of hepatotoxicity by the combination of Gemtuzumab ozogamicin and Teriflunomide. Hyper-lipoproteinaemia [5C80] [15]
BMS-201038 DMQTAGO Major Increased risk of hepatotoxicity by the combination of Gemtuzumab ozogamicin and BMS-201038. Hyper-lipoproteinaemia [5C80] [16]
Methotrexate DM2TEOL Moderate Increased risk of hepatotoxicity by the combination of Gemtuzumab ozogamicin and Methotrexate. Leukaemia [2A60-2B33] [8]
Denosumab DMNI0KO Moderate Additive myelosuppressive effects by the combination of Gemtuzumab ozogamicin and Denosumab. Low bone mass disorder [FB83] [17]
Calaspargase pegol DMQZBXI Moderate Increased risk of hepatotoxicity by the combination of Gemtuzumab ozogamicin and Calaspargase pegol. Malignant haematopoietic neoplasm [2B33] [11]
Cladribine DM3JDRP Major Additive myelosuppressive effects by the combination of Gemtuzumab ozogamicin and Cladribine. Mature B-cell leukaemia [2A82] [8]
Idelalisib DM602WT Moderate Increased risk of hepatotoxicity by the combination of Gemtuzumab ozogamicin and Idelalisib. Mature B-cell leukaemia [2A82] [18]
Alemtuzumab DMZL3IV Moderate Additive myelosuppressive effects by the combination of Gemtuzumab ozogamicin and Alemtuzumab. Mature B-cell leukaemia [2A82] [19]
Clofarabine DMCVJ86 Moderate Increased risk of hepatotoxicity by the combination of Gemtuzumab ozogamicin and Clofarabine. Mature B-cell lymphoma [2A85] [20]
Thalidomide DM70BU5 Major Additive thrombogenic effects by the combination of Gemtuzumab ozogamicin and Thalidomide. Multiple myeloma [2A83] [21]
Interferon beta-1a DM1A6RV Moderate Increased risk of hepatotoxicity by the combination of Gemtuzumab ozogamicin and Interferon beta-1a. Multiple sclerosis [8A40] [22]
Tecfidera DM2OVDT Moderate Additive immunosuppressive effects by the combination of Gemtuzumab ozogamicin and Tecfidera. Multiple sclerosis [8A40] [23]
Siponimod DM2R86O Major Additive immunosuppressive effects by the combination of Gemtuzumab ozogamicin and Siponimod. Multiple sclerosis [8A40] [24]
Fingolimod DM5JVAN Major Additive immunosuppressive effects by the combination of Gemtuzumab ozogamicin and Fingolimod. Multiple sclerosis [8A40] [25]
Interferon beta-1b DMCN61Z Moderate Increased risk of hepatotoxicity by the combination of Gemtuzumab ozogamicin and Interferon beta-1b. Multiple sclerosis [8A40] [22]
Ocrelizumab DMEZ2KH Moderate Additive immunosuppressive effects by the combination of Gemtuzumab ozogamicin and Ocrelizumab. Multiple sclerosis [8A40] [26]
Ozanimod DMT6AM2 Major Additive immunosuppressive effects by the combination of Gemtuzumab ozogamicin and Ozanimod. Multiple sclerosis [8A40] [8]
Omacetaxine mepesuccinate DMPU2WX Moderate Additive myelosuppressive effects by the combination of Gemtuzumab ozogamicin and Omacetaxine mepesuccinate. Myeloproliferative neoplasm [2A20] [27]
Efalizumab DMCKL5V Moderate Additive immunosuppressive effects by the combination of Gemtuzumab ozogamicin and Efalizumab. Psoriasis [EA90] [28]
Infliximab DMH7OIA Major Additive immunosuppressive effects by the combination of Gemtuzumab ozogamicin and Infliximab. Psoriasis [EA90] [29]
Gatifloxacin DMSL679 Minor Decreased absorption of Gemtuzumab ozogamicin due to intestinal mucosa variation caused by Gatifloxacin. Respiratory infection [CA07-CA4Z] [9]
Canakinumab DM8HLO5 Moderate Additive immunosuppressive effects by the combination of Gemtuzumab ozogamicin and Canakinumab. Rheumatoid arthritis [FA20] [30]
Rilonacept DMGLUQS Moderate Additive immunosuppressive effects by the combination of Gemtuzumab ozogamicin and Rilonacept. Rheumatoid arthritis [FA20] [30]
Golimumab DMHZV7X Major Additive immunosuppressive effects by the combination of Gemtuzumab ozogamicin and Golimumab. Rheumatoid arthritis [FA20] [29]
Leflunomide DMR8ONJ Major Additive immunosuppressive effects by the combination of Gemtuzumab ozogamicin and Leflunomide. Rheumatoid arthritis [FA20] [15]
Anthrax vaccine DM9GSWY Moderate Antagonize the effect of Gemtuzumab ozogamicin when combined with Anthrax vaccine. Sepsis [1G40-1G41] [31]
Trabectedin DMG3Y89 Moderate Increased risk of hepatotoxicity by the combination of Gemtuzumab ozogamicin and Trabectedin. Solid tumour/cancer [2A00-2F9Z] [8]
Epirubicin DMPDW6T Moderate Increased risk of hepatotoxicity by the combination of Gemtuzumab ozogamicin and Epirubicin. Solid tumour/cancer [2A00-2F9Z] [24]
Naltrexone DMUL45H Moderate Increased risk of hepatotoxicity by the combination of Gemtuzumab ozogamicin and Naltrexone. Substance abuse [6C40] [32]
Azathioprine DMMZSXQ Moderate Additive myelosuppressive effects by the combination of Gemtuzumab ozogamicin and Azathioprine. Transplant rejection [NE84] [24]
Cinoxacin DM4EWNS Minor Decreased absorption of Gemtuzumab ozogamicin due to intestinal mucosa variation caused by Cinoxacin. Urinary tract infection [GC08] [9]
Nalidixic acid DMRM0JV Minor Decreased absorption of Gemtuzumab ozogamicin due to intestinal mucosa variation caused by Nalidixic acid. Urinary tract infection [GC08] [9]
Enoxacin DMYTE6L Minor Decreased absorption of Gemtuzumab ozogamicin due to intestinal mucosa variation caused by Enoxacin. Urinary tract infection [GC08] [9]
Ganciclovir DM1MBYQ Moderate Additive myelosuppressive effects by the combination of Gemtuzumab ozogamicin and Ganciclovir. Virus infection [1A24-1D9Z] [24]
Valganciclovir DMS2IUH Moderate Additive myelosuppressive effects by the combination of Gemtuzumab ozogamicin and Valganciclovir. Virus infection [1A24-1D9Z] [24]
⏷ Show the Full List of 55 DDI Information of This Drug

References

1 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6775).
2 Pharmacokinetics of gemtuzumab ozogamicin as a single-agent treatment of pediatric patients with refractory or relapsed acute myeloid leukemia. J Clin Pharmacol. 2004 Aug;44(8):873-80.
3 Targeted treatment of acute myeloid leukemia in older adults: role of gemtuzumab ozogamicin. Clin Interv Aging. 2009;4:197-205.
4 Clinical pharmacokinetics of fibric acid derivatives (fibrates). Clin Pharmacokinet. 1998 Feb;34(2):155-62.
5 Product Information. Aubagio (teriflunomide). Genzyme Corporation, Cambridge, MA.
6 European Medicines Agency "Summary on compassionate use. Remdesivir Gilead.".
7 Product Information. Hivid (zalcitabine). Roche Laboratories, Nutley, NJ.
8 Cerner Multum, Inc. "UK Summary of Product Characteristics.".
9 Johnson EJ, MacGowan AP, Potter MN, et al "Reduced absorption of oral ciprofloxacin after chemotherapy for haematological malignancy." J Antimicrob Chemother 25 (1990): 837-42. [PMID: 2373666]
10 Product Information. Turalio (pexidartinib). Daiichi Sankyo, Inc., Parsippany, NJ.
11 Bodmer M, Sulz M, Stadlmann S, Droll A, Terracciano L, Krahenbuhl S "Fatal liver failure in an adult patient with acute lymphoblastic leukemia following treatment with L-asparaginase." Digestion 74 (2006): epub. [PMID: 16988508]
12 Product Information. Adcetris (brentuximab vedotin). Seattle Genetics Inc, Bothell, WA.
13 Elsharkawy AM, Schwab U, McCarron B, et al. "Efavirenz induced acute liver failure requiring liver transplantation in a slow drug metaboliser." J Clin Virol 58 (2013): 331-3. [PMID: 23763943]
14 Product Information. Kynamro (mipomersen). Genzyme Corporation, Cambridge, MA.
15 Product Information. Arava (leflunomide). Hoechst Marion-Roussel Inc, Kansas City, MO.
16 Product Information. Juxtapid (lomitapide). Aegerion Pharmaceuticals Inc, Cambridge, MA.
17 Product Information. Lonsurf (tipiracil-trifluridine). Taiho Oncology, Inc., Princeton, NJ.
18 Product Information. Zydelig (idelalisib). Gilead Sciences, Foster City, CA.
19 Product Information. Campath (alemtuzumab) Berlex, Richmond, CA.
20 Product Information. Clolar (clofarabine). sanofi-aventis, Bridgewater, NJ.
21 Figg WD, Arlen P, Gulley J, et al. "A randomized phase II trial of docetaxel (taxotere) plus thalidomide in androgen-independent prostate cancer." Semin Oncol 28(4 Suppl 15) (2001): 62-6. [PMID: 11685731]
22 Product Information. Betaseron (interferon beta-1b). Berlex, Richmond, CA.
23 Product Information. Vumerity (diroximel fumarate). Alkermes, Inc, Cambridge, MA.
24 Cerner Multum, Inc. "Australian Product Information.".
25 Product Information. Gilenya (fingolimod). Novartis Pharmaceuticals, East Hanover, NJ.
26 Product Information. Ocrevus (ocrelizumab). Genentech, South San Francisco, CA.
27 Product Information. Synribo (omacetaxine). Teva Pharmaceuticals USA, North Wales, PA.
28 Product Information. Raptiva (efalizumab). Genentech, South San Francisco, CA.
29 Product Information. Cimzia (certolizumab). UCB Pharma Inc, Smyrna, GA.
30 Product Information. Arcalyst (rilonacept). Regeneron Pharmaceuticals Inc, Tarrytown, NY.
31 CDC. Centers for Disease Control and Prevention/ "Recommendations of the advisory committtee on immunization practices (ACIP): use of vaccines and immune globulins in persons with altered immunocompetence." MMWR Morb Mortal Wkly Rep 42(RR-04) (1993): 1-18. [PMID: 20300058]
32 Product Information. ReVia (naltrexone). DuPont Pharmaceuticals, Wilmington, DE.