Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT1MPAY)

• DTT Name: GABA(A) receptor alpha-1 (GABRA1)
• Synonyms: Gamma-aminobutyric acid receptor subunit alpha-1; GABA(A) receptor subunit alpha-1
• Gene Name: GABRA1
• DTT Type: Successful target; [1]
• Related Disease:
  Acute respiratory distress syndrome [ICD-11: CB00]
  Anxiety disorder [ICD-11: 6B00-6B0Z]
  Chronic insomnia [ICD-11: 7A00]
  Chronic pain [ICD-11: MG30]
  Corneal disease [ICD-11: 9A76-9A78]
  Cystitis [ICD-11: GC00]
  Depression [ICD-11: 6A70-6A7Z]
  Epilepsy/seizure [ICD-11: 8A61-8A6Z]
  Headache [ICD-11: 8A80-8A84]
  Insomnia [ICD-11: 7A00-7A0Z]
  Malaria [ICD-11: 1F40-1F45]
  Mental/behavioural/neurodevelopmental disorder [ICD-11: 6E20-6E8Z]
  Tonus and reflex abnormality [ICD-11: MB47]
• BioChemical Class: Ligand-gated ion channel
• UniProt ID: GBRA1_HUMAN
• TTD ID: T51487
• Sequence:
  MRKSPGLSDCLWAWILLLSTLTGRSYGQPSLQDELKDNTTVFTRILDRLLDGYDNRLRPG
  LGERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGPMTVLRLNNLMASK
  IWTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAECPMHLEDFPMDAHAC
  PLKFGSYAYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVM
  TTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISA
  RNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGYAWDGKSVVPEKPKKVKDP
  LIKKNNTYAPTATSYTPNLARGDPGLATIAKSATIEPKEVKPETKPPEPKKTFNSVSKID
  RLSRIAFPLLFGIFNLVYWATYLNREPQLKAPTPHQ
• Function: Ligand-gated chloride channel which is a component of the heteropentameric receptor for GABA, the major inhibitory neurotransmitter in the brain. Plays an important role in the formation of functional inhibitory GABAergic synapses in addition to mediating synaptic inhibition as a GABA-gated ion channel. The gamma2 subunit is necessary but not sufficient for a rapid formation of active synaptic contacts and the synaptogenic effect of this subunit is influenced by the type of alpha and beta subunits present in the receptor pentamer (By similarity). The alpha1/beta2/gamma2 receptor and the alpha1/beta3/gamma2 receptor exhibit synaptogenic activity. GABRA1-mediated plasticity in the orbitofrontal cortex regulates context-dependent action selection (By similarity). Functions also as histamine receptor and mediates cellular responses to histamine (By similarity).
• KEGG Pathway:
  Neuroactive ligand-receptor interaction (hsa04080)
  Retrograde endocannabinoid signaling (hsa04723)
  GABAergic synapse (hsa04727)
  Morphine addiction (hsa05032)
  Nicotine addiction (hsa05033)
• Reactome Pathway:
  GABA A receptor activation (R-HSA-977441)
  Ligand-gated ion channel transport (R-HSA-975298)

Molecular Interaction Atlas (MIA) of This DTT

25 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Allopregnanolone	DMNLHAC	Depression	6A70-6A7Z	Approved	[2]
Amobarbital	DM0GQ8N	Insomnia	7A00-7A0Z	Approved	[1], [3]
Barbital	DMJ8NMC	Insomnia	7A00-7A0Z	Approved	[1], [3]
Barbiturate	DMJIA6T	Anaesthesia	9A78.6	Approved	[1], [3]
Butabarbital	DMC5AST	Insomnia	7A00-7A0Z	Approved	[1], [4], [3]
Butalbital	DM9J04X	Anxiety disorder	6B00-6B0Z	Approved	[1]
Butethal	DM7JHX0	Insomnia	7A00-7A0Z	Approved	[1]
Clobazam - Lundbeck	DMW1OQ0	Anxiety disorder	6B00-6B0Z	Approved	[1]
Ethanol	DMDRQZU	Chronic pain	MG30	Approved	[1]
Ethchlorvynol	DM53IP1	Insomnia	7A00-7A0Z	Approved	[1]
Hexobarbital	DMQ314B	Anaesthesia	9A78.6	Approved	[1], [3]
Indiplon	DMOPGHQ	Fibromyalgia	MG30.01	Approved	[5], [6]
Meprobamate	DMHM93Y	Anxiety disorder	6B00-6B0Z	Approved	[1]
Methohexital	DM7YMIT	Anaesthesia	9A78.6	Approved	[1]
Methoxyflurane	DML0RAE	Anaesthesia	9A78.6	Approved	[1]
Methylphenobarbital	DMDSWAG	Anxiety disorder	6B00-6B0Z	Approved	[1], [3]
Methyprylon	DMBW7VH	Insomnia	7A00-7A0Z	Approved	[1]
Nitrazepam	DMEGIQ6	Epilepsy	8A60-8A68	Approved	[1]
Pentobarbital	DMFNH7L	Insomnia	7A00-7A0Z	Approved	[1], [3]
Picrotoxin	DMIBNG2	Respiratory distress syndrome	CB00	Approved	[1]
Primidone	DM0WX6I	Epilepsy	8A60-8A68	Approved	[1]
Secobarbital	DM14RF5	Intractable insomnia	7A00	Approved	[1], [3]
THIOCOLCHICOSIDE	DMEPWYA	Muscle spasm	MB47.3	Approved	[7]
Zaleplon	DMGFWSM	Insomnia	7A00-7A0Z	Approved	[8]
Zolpidem	DMWOSKJ	Insomnia	7A00-7A0Z	Approved	[9]

3 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
ZK-93423	DMFWMKZ	Epileptic seizures	8A61-8A6Z	Phase 3	[10]
EVT-201	DMQGBM1	Insomnia	7A00-7A0Z	Phase 2	[11]
GSK683699	DMTW79H	Inflammatory bowel disease	DD72	Phase 2	[7]

4 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
ELTANOLONE	DM38CIV	Premenstrual syndrome	GA34.40	Discontinued in Phase 3	[2]
U-78875	DM2WOPX	Anxiety disorder	6B00-6B0Z	Discontinued in Phase 1	[12]
CGS-9896	DM39PQI	N. A.	N. A.	Terminated	[13]
Divaplon	DMO3XBP	N. A.	N. A.	Terminated	[14]

161 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
(2-Amino-4,5-dihydro-thiazol-4-yl)-acetic acid	DMLEZKJ	Discovery agent	N.A.	Investigative	[15]
(2E,4S)-4-ammoniopent-2-enoate	DMA9RIS	Discovery agent	N.A.	Investigative	[16]
(4R)-4-ammoniopentanoate	DMZFTI4	Discovery agent	N.A.	Investigative	[16]
(4S)-4-ammoniopentanoate	DMBLAY1	Discovery agent	N.A.	Investigative	[16]
(6-Benzylamino-9H-beta-carbolin-3-yl)-methanol	DMAXS9H	Discovery agent	N.A.	Investigative	[17]
(9-Benzyl-9H-purin-6-yl)-cyclopropyl-amine	DMHJG5N	Discovery agent	N.A.	Investigative	[18]
(9H-beta-Carbolin-3-yl)-carbamic acid ethyl ester	DMKI2Y9	Discovery agent	N.A.	Investigative	[19]
(9H-beta-Carbolin-3-yl)-ethyl-amine	DMVHMPC	Discovery agent	N.A.	Investigative	[19]
(9H-beta-Carbolin-3-yl)-methanol	DMUF16A	Discovery agent	N.A.	Investigative	[17]
(beta-CCE)9H-beta-Carboline-3-carboxylic acid	DMVWQ26	Discovery agent	N.A.	Investigative	[20]
1,1-Dimethyl-5-oxa-spiro[2.4]heptan-4-one	DMOGHRS	Discovery agent	N.A.	Investigative	[21]
1,3-Diphenyl-1H-chromeno[4,3-c]pyrazol-4-one	DM1KND6	Discovery agent	N.A.	Investigative	[22]
1-(4-chlorophenyl)-4-phenyl-1H-imidazole	DMVCHSI	Discovery agent	N.A.	Investigative	[13]
1-(9H-beta-Carbolin-3-yl)-butan-1-one	DMA96U5	Discovery agent	N.A.	Investigative	[23]
1-(9H-beta-Carbolin-3-yl)-ethanone	DMFOD2L	Discovery agent	N.A.	Investigative	[17]
1-Methyl-5-oxa-spiro[2.4]heptan-4-one	DMX2FWN	Discovery agent	N.A.	Investigative	[21]
2-(1H-Indol-3-yl)-2-oxo-N-phenethyl-acetamide	DMFAME4	Discovery agent	N.A.	Investigative	[20]
2-(3-Bromo-phenyl)-6-nitro-chromen-4-one	DM9RAYC	Discovery agent	N.A.	Investigative	[24]
2-(3-Bromo-phenyl)-chromen-4-one	DM7XDLO	Discovery agent	N.A.	Investigative	[24]
2-(3-Chloro-phenyl)-chromen-4-one	DML83DM	Discovery agent	N.A.	Investigative	[24]
2-(4-Chloro-phenyl)-3H-imidazo[4,5-c]quinoline	DMSB0JA	Discovery agent	N.A.	Investigative	[25]
2-(4-chlorophenyl)-5-phenyl-4-isoxazolin-3-one	DMYGRS9	Discovery agent	N.A.	Investigative	[13]
2-(9-Benzyl-9H-purin-6-ylamino)-ethanol	DMPJ0O6	Discovery agent	N.A.	Investigative	[18]
2-Furan-2-yl-6H-pyrazolo[1,5-c]quinazolin-5-one	DMHT80R	Discovery agent	N.A.	Investigative	[26]
2-Isoxazol-3-yl-3H-imidazo[4,5-c]quinoline	DM1F4TN	Discovery agent	N.A.	Investigative	[25]
2-Isoxazol-5-yl-3H-imidazo[4,5-c]quinoline	DMD2ZNA	Discovery agent	N.A.	Investigative	[25]
2-Oxa-spiro[4.4]nonan-1-one	DM2NEX4	Discovery agent	N.A.	Investigative	[21]
2-p-Tolyl-6H-pyrazolo[1,5-c]quinazolin-5-one	DMJIVL3	Discovery agent	N.A.	Investigative	[26]
2-Phenyl-3H-imidazo[4,5-c]quinoline	DML9DJP	Discovery agent	N.A.	Investigative	[25]
2-Phenyl-5,6-dihydro-pyrazolo[1,5-c]quinazoline	DMUIYZB	Discovery agent	N.A.	Investigative	[26]
2-Phenyl-6H-pyrazolo[1,5-c]quinazolin-5-one	DMA1RHE	Discovery agent	N.A.	Investigative	[26]
2-Pyridin-2-yl-6H-pyrazolo[1,5-c]quinazolin-5-one	DMLCDZN	Discovery agent	N.A.	Investigative	[26]
2-Thiophen-2-yl-3H-imidazo[4,5-c]quinoline	DMPF598	Discovery agent	N.A.	Investigative	[25]
3,3-Diethyl-dihydro-furan-2-one	DMFJ9N0	Discovery agent	N.A.	Investigative	[21]
3,3-Diisopropyl-dihydro-furan-2-one	DMIFUDG	Discovery agent	N.A.	Investigative	[21]
3-(2,2-Dimethyl-propoxy)-9H-beta-carboline	DMSCIP2	Discovery agent	N.A.	Investigative	[23]
3-(3-Methyl-butoxy)-9H-beta-carboline	DMTNCXP	Discovery agent	N.A.	Investigative	[23], [27]
3-(benzyloxy)-9H-pyrido[3,4-b]indole	DMDNEKR	Discovery agent	N.A.	Investigative	[27]
3-(hexa-1,3-dienyloxy)-9H-pyrido[3,4-b]indole	DMKHNTY	Discovery agent	N.A.	Investigative	[27]
3-amino-3-demethoxythiocolchicine	DM60K7H	Discovery agent	N.A.	Investigative	[7]
3-Butoxy-9H-beta-carboline	DMQ8H74	Discovery agent	N.A.	Investigative	[23], [27]
3-butoxycarbonyl-4-quinolone	DMRF2Q8	Discovery agent	N.A.	Investigative	[28]
3-butoxycarbonyl-6-ethyl-4-quinolone	DMD6PMZ	Discovery agent	N.A.	Investigative	[28]
3-butylaminocarbonyl-6-ethyl-4-quinolone	DM95XWR	Discovery agent	N.A.	Investigative	[28]
3-carboxy-6-ethyl-4-quinolone	DMRUX93	Discovery agent	N.A.	Investigative	[28]
3-Chloro-9H-beta-carboline	DMCD901	Discovery agent	N.A.	Investigative	[29]
3-cyclopentoxycarbonyl-6-ethyl-4-quinolone	DMEL8S5	Discovery agent	N.A.	Investigative	[28]
3-demethoxy-3-D-lyxopyranosylaminothiocolchicine	DME8VPC	Discovery agent	N.A.	Investigative	[7]
3-demethoxy-3-D-mannopyranosylaminothiocolchicine	DMALMGH	Discovery agent	N.A.	Investigative	[7]
3-demethoxy-3-D-xylopyranosylaminothiocolchicine	DMXFVD1	Discovery agent	N.A.	Investigative	[7]
3-demethoxy-3-L-fucopyranosylaminothiocolchicine	DM4ERYF	Discovery agent	N.A.	Investigative	[7]
3-demethoxy-3D-glucopyranosylaminothiocolchicine	DMID7TC	Discovery agent	N.A.	Investigative	[7]
3-Ethoxy-9H-beta-carboline	DM6K7BI	Discovery agent	N.A.	Investigative	[29], [27]
3-ethoxycarbonyl-4-quinolone	DMY4VOI	Discovery agent	N.A.	Investigative	[28]
3-ethoxycarbonyl-6-ethyl-2-methyl-4-quinolone	DMMDOI4	Discovery agent	N.A.	Investigative	[28]
3-ethoxycarbonyl-6-propyl-4-quinolone	DM1E5QZ	Discovery agent	N.A.	Investigative	[28]
3-Ethyl-3-isopropyl-dihydro-furan-2-one	DMZK13I	Discovery agent	N.A.	Investigative	[21]
3-Ethyl-3-methyl-dihydro-furan-2-one	DM1VTFU	Discovery agent	N.A.	Investigative	[21]
3-Isobutoxy-9H-beta-carboline	DM6X5TZ	Discovery agent	N.A.	Investigative	[23], [27]
3-Isopropoxy-9H-beta-carboline	DM7PHO4	Discovery agent	N.A.	Investigative	[23]
3-Isopropyl-3-methyl-dihydro-furan-2-one	DMSLPGZ	Discovery agent	N.A.	Investigative	[21]
3-Isothiocyanato-9H-beta-carboline	DM9LEWH	Discovery agent	N.A.	Investigative	[30]
3-Methoxy-9H-beta-carboline	DMTBX0D	Discovery agent	N.A.	Investigative	[29]
3-Methoxycarbonyl-2-methyl-9H-beta-carbolin-2-ium	DMQMT1A	Discovery agent	N.A.	Investigative	[31]
3-Methyl-1-phenyl-1H-chromeno[4,3-c]pyrazol-4-one	DMTM6B0	Discovery agent	N.A.	Investigative	[22]
3-Methyl-2-phenyl-2H-chromeno[4,3-c]pyrazol-4-one	DM870UV	Discovery agent	N.A.	Investigative	[22]
3-Methyl-9H-beta-carboline	DMEJKZN	Discovery agent	N.A.	Investigative	[32]
3-Nitro-9H-beta-carboline	DM08V9W	Discovery agent	N.A.	Investigative	[29]
3-Propoxy-9H-beta-carboline	DMDEV64	Discovery agent	N.A.	Investigative	[29], [27]
3-sec-Butoxy-9H-beta-carboline	DMNP8DQ	Discovery agent	N.A.	Investigative	[23]
3-tert-Butyl-3-ethyl-dihydro-furan-2-one	DMGDT8V	Discovery agent	N.A.	Investigative	[21]
4-(2-aminoethyl)-1,2,5-oxadiazol-3-ol	DMCS538	Discovery agent	N.A.	Investigative	[33]
4-(4-chlorophenyl)-1-pyrid-2-yl-pyrazole	DMJI6QH	Discovery agent	N.A.	Investigative	[13]
4-(biphenyl-3-yl)-5-(piperidin-4-yl)isoxazol-3-ol	DM1T95Y	Discovery agent	N.A.	Investigative	[34]
4-benzyl-5-(4-piperidyl)isothiazol-3-ol	DMZ18OJ	Discovery agent	N.A.	Investigative	[35]
4-Benzyl-5-piperidin-4-yl-isoxazol-3-ol	DMA4CZK	Discovery agent	N.A.	Investigative	[36]
4-Methoxymethyl-3,6-dipropoxy-9H-beta-carboline	DMCS83F	Discovery agent	N.A.	Investigative	[37]
4-Methyl-5-(4-piperidyl)isothiazol-3-ol	DMV19HC	Discovery agent	N.A.	Investigative	[35]
4-Naphthalen-1-yl-5-piperidin-4-yl-isoxazol-3-ol	DMEIA3L	Discovery agent	N.A.	Investigative	[36]
4-Naphthalen-2-yl-5-piperidin-4-yl-isoxazol-3-ol	DM9O8UM	Discovery agent	N.A.	Investigative	[36]
4-Phenyl-5-piperidin-4-yl-isoxazol-3-ol	DM7E4JU	Discovery agent	N.A.	Investigative	[36]
5-(4-piperidyl)-4-propylisothiazol-3-ol	DMZ7K5G	Discovery agent	N.A.	Investigative	[35]
5-(piperidin-4-yl)isothiazol-3-ol	DM4XGFW	Discovery agent	N.A.	Investigative	[35]
5-(piperidin-4-yl)isoxazol-3-ol	DM6GO2I	Discovery agent	N.A.	Investigative	[36]
5-[(1R)-1-ammonioethyl]isoxazol-3-olate	DM23PL4	Discovery agent	N.A.	Investigative	[16]
5-[(1S)-1-ammonioethyl]isoxazol-3-olate	DMYAPLT	Discovery agent	N.A.	Investigative	[16]
6,6-Dimethyl-2-oxa-spiro[4.4]nonan-1-one	DMOIFAP	Discovery agent	N.A.	Investigative	[21]
6,9-Dimethyl-2-oxa-spiro[4.4]nonan-1-one	DM7FMWS	Discovery agent	N.A.	Investigative	[21]
6-benzyl-3-ethoxycarbonyl-4-quinolone	DMICRFQ	Discovery agent	N.A.	Investigative	[28]
6-benzyl-3-propoxycarbonyl-4-quinolone	DMXMI5E	Discovery agent	N.A.	Investigative	[28]
6-benzyl-3-propylaminocarbonyl-4-quinolone	DM7HNPJ	Discovery agent	N.A.	Investigative	[28]
6-Bromo-2-(2-nitro-phenyl)-chromen-4-one	DM7U58O	Discovery agent	N.A.	Investigative	[38]
6-Bromo-2-(3-bromo-phenyl)-chromen-4-one	DMTJRF3	Discovery agent	N.A.	Investigative	[24]
6-Bromo-2-(3-nitro-phenyl)-chromen-4-one	DMP8ZVS	Discovery agent	N.A.	Investigative	[38]
6-Bromo-2-(4-nitro-phenyl)-chromen-4-one	DMCX3TM	Discovery agent	N.A.	Investigative	[38]
6-Bromo-2-phenyl-chromen-4-one	DMMCNQI	Discovery agent	N.A.	Investigative	[24]
6-bromo-3-ethoxycarbonyl-2-methyl-4-quinolone	DM4HRIX	Discovery agent	N.A.	Investigative	[28]
6-bromo-3-ethoxycarbonyl-4-quinolone	DM0MQHP	Discovery agent	N.A.	Investigative	[28]
6-Chloro-2-(3-nitro-phenyl)-chromen-4-one	DMTWBOV	Discovery agent	N.A.	Investigative	[24]
6-Chloro-2-phenyl-chromen-4-one	DM5FZDI	Discovery agent	N.A.	Investigative	[24]
6-ethyl-3-(2-ethylbutoxycarbonyl)-4-quinolone	DMLEUP2	Discovery agent	N.A.	Investigative	[28]
6-ethyl-3-(2-methylbutoxycarbonyl)-4-quinolone	DMESU53	Discovery agent	N.A.	Investigative	[28]
6-ethyl-3-(3-methylbutoxycarbonyl)-4-quinolone	DM1POEA	Discovery agent	N.A.	Investigative	[28]
6-ethyl-3-(3-pentoxycarbonyl)-4-quinolone	DMG05V1	Discovery agent	N.A.	Investigative	[28]
6-ethyl-3-i-propoxycarbonyl-4-quinolone	DML9EU7	Discovery agent	N.A.	Investigative	[28]
6-ethyl-3-pentoxycarbonyl-4-quinolone	DMSGJM6	Discovery agent	N.A.	Investigative	[28]
6-ethyl-3-propoxycarbonyl-4-quinolone	DMGVI08	Discovery agent	N.A.	Investigative	[28]
6-ethyl-3-propylaminocarbonyl-4-quinolone	DMC1F2E	Discovery agent	N.A.	Investigative	[28]
6-Fluoro-2-(3-nitro-phenyl)-chromen-4-one	DMPZIV0	Discovery agent	N.A.	Investigative	[24]
6-Methyl-2-oxa-spiro[4.4]nonan-1-one	DMNJRFP	Discovery agent	N.A.	Investigative	[21]
6-Nitro-2-(3-nitro-phenyl)-chromen-4-one	DMRCTBA	Discovery agent	N.A.	Investigative	[39]
6-Nitro-2-(4-nitro-phenyl)-chromen-4-one	DMM635K	Discovery agent	N.A.	Investigative	[39]
6-Nitro-2-phenyl-chromen-4-one	DMVLID9	Discovery agent	N.A.	Investigative	[24]
7,12-Dihydro-5,7,12-triaza-indeno[1,2-a]fluorene	DM3FXRC	Discovery agent	N.A.	Investigative	[40]
7,12-Dihydro-7,12-diaza-indeno[1,2-a]fluorene	DMTZ943	Discovery agent	N.A.	Investigative	[29]
9H-beta-Carbolin-3-ol	DMBWAMR	Discovery agent	N.A.	Investigative	[29]
9H-beta-Carbolin-6-ylamine	DMBLEI7	Discovery agent	N.A.	Investigative	[17]
9H-beta-Carboline-3-carboxylic acid ethyl ester	DMK459I	Discovery agent	N.A.	Investigative	[27], [41]
9H-beta-Carboline-3-carboxylic acid propyl ester	DMMUH98	Discovery agent	N.A.	Investigative	[41]
AMENTOFLAVONE	DMLRNV2	Discovery agent	N.A.	Investigative	[42]
Barbituric acid derivative	DM2I19P	Discovery agent	N.A.	Investigative	[43]
Benzyl-(9H-beta-carbolin-6-yl)-amine	DMW167A	Discovery agent	N.A.	Investigative	[29]
Beta-Carboline-3-carboxylic acid t-butyl ester	DM9LT60	N. A.	N. A.	Investigative	[27]
BETA-CCM	DM1MFTZ	Discovery agent	N.A.	Investigative	[44]
CGS-13767	DM4DSE7	Discovery agent	N.A.	Investigative	[45]
CGS-9895	DMKY6CU	Discovery agent	N.A.	Investigative	[46]
CI-218872	DM0RH3S	Discovery agent	N.A.	Investigative	[32]
Ethyl 6-iodo-9H-pyrido[3,4-b]indole-3-carboxylate	DM5G91Z	Discovery agent	N.A.	Investigative	[27]
Flavone	DMEQH6J	Discovery agent	N.A.	Investigative	[24]
GNF-PF-3645	DM17GIV	Discovery agent	N.A.	Investigative	[28]
GNF-PF-4421	DMV10UH	Discovery agent	N.A.	Investigative	[28]
Isoquinoline-3-carboxylic acid methyl ester	DMWIMUZ	Discovery agent	N.A.	Investigative	[29]
L-655708	DM4CDIB	Discovery agent	N.A.	Investigative	[47]
N-(9H-beta-Carbolin-3-yl)-acetamide	DMBD52I	Discovery agent	N.A.	Investigative	[19]
N-(9H-beta-Carbolin-3-yl)-formamide	DM3KNSY	Discovery agent	N.A.	Investigative	[19]
N-(p-methylbenzyl)-5-nitroindol-3-ylglyoxylamide	DMULBO9	Discovery agent	N.A.	Investigative	[48]
N-Benzyl-2-(1H-indol-3-yl)-2-oxo-acetamide	DM8A23B	Discovery agent	N.A.	Investigative	[48]
N-benzyl-2-(5-nitro-1H-indol-3-yl)-2-oxoacetamide	DMMT65J	Discovery agent	N.A.	Investigative	[48]
N-butyl-2-(1H-indol-3-yl)-2-oxoacetamide	DM157LQ	Discovery agent	N.A.	Investigative	[48]
N-butyl-2-(5-nitro-1H-indol-3-yl)-2-oxoacetamide	DMH7Z4L	Discovery agent	N.A.	Investigative	[48]
N-Indan-1-yl-2-(1H-indol-3-yl)-2-oxo-acetamide	DM8ZMB5	Discovery agent	N.A.	Investigative	[49]
NORHARMANE	DMKYQWG	Discovery agent	N.A.	Investigative	[29]
NSC-73613	DMT6CV5	Discovery agent	N.A.	Investigative	[24]
NSC-93394	DM2JPD4	Discovery agent	N.A.	Investigative	[24]
Pyrrolidin-3-yl-acetic acid	DM0BHCJ	Discovery agent	N.A.	Investigative	[50]
Ridine-5-carboxylic acid ethyl ester	DM9HMCS	Discovery agent	N.A.	Investigative	[51]
RIPAZEPAM	DMTHVQD	Discovery agent	N.A.	Investigative	[52]
RO-054520	DM78B4A	Discovery agent	N.A.	Investigative	[53]
RO-145974	DM0ACKJ	Discovery agent	N.A.	Investigative	[54]
RO-145975	DMAJ6BW	Discovery agent	N.A.	Investigative	[54]
RO-147437	DMX4B36	Discovery agent	N.A.	Investigative	[54]
Ro-15-3505	DM4NW3U	Discovery agent	N.A.	Investigative	[54]
RO-194603	DM8C2Z0	Discovery agent	N.A.	Investigative	[54]
Ro-4938581	DMCB2N9	Discovery agent	N.A.	Investigative	[55]
RWJ-16979	DME68VT	Discovery agent	N.A.	Investigative	[56]
RY-066	DMGUX16	Discovery agent	N.A.	Investigative	[57]
Sec-butyl 9H-pyrido[3,4-b]indole-3-carboxylate	DM9QSDC	Discovery agent	N.A.	Investigative	[27]
U-89267	DMQT6AH	Discovery agent	N.A.	Investigative	[58]
[3H]CGP27492	DMQTBRM	Discovery agent	N.A.	Investigative	[59]
[3H]CGS8216	DMLP68J	Inflammation	1A00-CA43.1	Investigative	[45]
[3H]Ro154513	DMMBWKL	Discovery agent	N.A.	Investigative	[54]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Major depressive disorder	6A20	Pre-frontal cortex	9.57E-01	-0.12	-0.18

References

• [1] DrugBank: a knowledgebase for drugs, drug actions and drug targets. Nucleic Acids Res. 2008 Jan;36(Database issue):D901-6.
• [2] Neurosteroid analogues. 10. The effect of methyl group substitution at the C-6 and C-7 positions on the GABA modulatory and anesthetic actions of (... J Med Chem. 2005 Apr 21;48(8):3051-9.
• [3] Effect of barbiturates on polyphosphoinositide biosynthesis and protein kinase C activity in synaptosomes. Neuropharmacology. 1989 Dec;28(12):1317-23.
• [4] Hypnotic drugs. Med Lett Drugs Ther. 2000 Aug 7;42(1084):71-2.
• [5] Emerging therapies for fibromyalgia. Expert Opin Emerg Drugs. 2008 Mar;13(1):53-62.
• [6] Glutamate- and GABA-based CNS therapeutics. Curr Opin Pharmacol. 2006 Feb;6(1):7-17.
• [7] 3-demethoxy-3-glycosylaminothiocolchicines: Synthesis of a new class of putative muscle relaxant compounds. J Med Chem. 2006 Sep 7;49(18):5571-7.
• [8] Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
• [9] Zolpidem, a selective GABA(A) receptor alpha1 subunit agonist, induces comparable Fos expression in oxytocinergic neurons of the hypothalamic paraventricular and accessory but not supraoptic nuclei in the rat.Brain Res Bull.2006 Dec 11;71(1-3):200-7.
• [10] Structural requirements for agonist actions at the benzodiazepine receptor: studies with analogues of 6-(benzyloxy)-4-(methoxymethyl)-beta-carbolin... J Med Chem. 1990 Mar;33(3):1062-9.
• [11] Antibodies and venom peptides: new modalities for ion channels. Nat Rev Drug Discov. 2019 May;18(5):339-357.
• [12] Piperazine imidazo[1,5-a]quinoxaline ureas as high-affinity GABAA ligands of dual functionality. J Med Chem. 1999 Apr 8;42(7):1123-44.
• [13] Synthesis, pharmacology, and structure-activity relationships of novel imidazolones and pyrrolones as modulators of GABAA receptors. J Med Chem. 2006 Mar 23;49(6):1855-66.
• [14] (Imidazo[1,2-a]pyrimidin-2-yl)phenylmethanones and related compounds as potential nonsedative anxiolytics. J Med Chem. 1988 Jun;31(6):1220-6.
• [15] ( )-2-amino-2-thiazoline-4-ethanoic acid; a novel, specific GABAA receptor agonist. Bioorg. Med. Chem. Lett. 1(5):247-248 (1991).
• [16] gamma-Aminobutyric acid agonists, antagonists, and uptake inhibitors. Design and therapeutic aspects. J Med Chem. 1981 Dec;24(12):1377-83.
• [17] Synthesis of 6-substituted beta-carbolines that behave as benzodiazepine receptor antagonists or inverse agonists. J Med Chem. 1987 Apr;30(4):750-3.
• [18] Benzodiazepine receptor binding activity of 6,9-disubstituted purines. J Med Chem. 1989 May;32(5):1020-4.
• [19] 3-Amino-beta-carboline derivatives and the benzodiazepine receptor. Synthesis of a selective antagonist of the sedative action of diazepam. J Med Chem. 1985 Jun;28(6):824-8.
• [20] Benzodiazepine receptor affinity and interaction of some N-(indol-3-ylglyoxylyl)amine derivatives. J Med Chem. 1992 Jun 12;35(12):2214-20.
• [21] Alpha-spirocyclopentyl- and alpha-spirocyclopropyl-gamma-butyrolactones: conformationally constrained derivatives of anticonvulsant and convulsant ... J Med Chem. 1994 Jan 21;37(2):275-86.
• [22] Synthesis, binding studies, and structure-activity relationships of 1-aryl-and 2-aryl[1]benzopyranopyrazol-4-ones, central benzodiazepine receptor ... J Med Chem. 1988 Jan;31(1):1-3.
• [23] Predictive binding of beta-carboline inverse agonists and antagonists via the CoMFA/GOLPE approach. J Med Chem. 1992 Oct 30;35(22):4001-10.
• [24] Synthesis of halogenated/nitrated flavone derivatives and evaluation of their affinity for the central benzodiazepine receptor, Bioorg. Med. Chem. Lett. 7(15):2003-2008 (1997).
• [25] Synthesis and structure--activity relationships of fused imidazopyridines: a new series of benzodiazepine receptor ligands. J Med Chem. 1996 Jul 5;39(14):2844-51.
• [26] Synthesis and binding activity of some pyrazolo[1,5-c]quinazolines as tools to verify an optional binding site of a benzodiazepine receptor ligand. J Med Chem. 1996 Jul 19;39(15):2915-21.
• [27] Design, synthesis, and subtype selectivity of 3,6-disubstituted -carbolines at Bz/GABA(A)ergic receptors. SAR and studies directed toward agents f... Bioorg Med Chem. 2010 Nov 1;18(21):7548-64.
• [28] 4-quinolone derivatives: high-affinity ligands at the benzodiazepine site of brain GABA A receptors. synthesis, pharmacology, and pharmacophore mod... J Med Chem. 2006 Apr 20;49(8):2526-33.
• [29] Synthesis of novel 3-substituted beta-carbolines as benzodiazepine receptor ligands: probing the benzodiazepine receptor pharmacophore. J Med Chem. 1988 Sep;31(9):1854-61.
• [30] Synthetic and computer-assisted analyses of the pharmacophore for the benzodiazepine receptor inverse agonist site. J Med Chem. 1990 Sep;33(9):2343-57.
• [31] N-2 methylated quaternary derivatives of beta-carboline-3-carboxylates inhibit acetylcholinesterase in vitroO, Bioorg. Med. Chem. Lett. 3(12):2831-2836 (1993).
• [32] Four amino acid exchanges convert a diazepam-insensitive, inverse agonist-preferring GABAA receptor into a diazepam-preferring GABAA receptor. J Med Chem. 1994 Dec 23;37(26):4576-80.
• [33] Hydroxy-1,2,5-oxadiazolyl moiety as bioisoster of the carboxy function. Synthesis, ionization constants, and pharmacological characterization of ga... J Med Chem. 2006 Jul 13;49(14):4442-6.
• [34] Novel 4-(piperidin-4-yl)-1-hydroxypyrazoles as gamma-aminobutyric acid(A) receptor ligands: synthesis, pharmacology, and structure-activity relatio... J Med Chem. 2010 Apr 22;53(8):3417-21.
• [35] Potent 4-arylalkyl-substituted 3-isothiazolol GABA(A) competitive/noncompetitive antagonists: synthesis and pharmacology. J Med Chem. 2006 Feb 23;49(4):1388-96.
• [36] Potent 4-aryl- or 4-arylalkyl-substituted 3-isoxazolol GABA(A) antagonists: synthesis, pharmacology, and molecular modeling. J Med Chem. 2005 Jan 27;48(2):427-39.
• [37] Synthesis and evaluation of analogues of the partial agonist 6-(propyloxy)-4-(methoxymethyl)-beta-carboline-3-carboxylic acid ethyl ester (6-PBC) a... J Med Chem. 1998 Jul 2;41(14):2537-52.
• [38] 6-Bromo-3 nitroflavone, a new high affinity benzodiazepine receptor agonist recognizes two populations of cerebral cortical binding sites, Bioorg. Med. Chem. Lett. 7(3):373-378 (1997).
• [39] 6,3'-Dinitroflavone, a novel high affinity ligand for the benzodiazepine receptor with potent anxiolytic properties, Bioorg. Med. Chem. Lett. 5(22):2717-2720 (1995).
• [40] Synthesis of 7,12-dihydropyrido[3,4-b:5,4-b']diindoles. A novel class of rigid, planar benzodiazepine receptor ligands. J Med Chem. 1987 Mar;30(3):456-8.
• [41] beta-Carbolines as benzodiazepine receptor ligands. 1. Synthesis and benzodiazepine receptor interaction of esters of beta-carboline-3-carboxylic a... J Med Chem. 1983 Apr;26(4):499-503.
• [42] Semisynthetic preparation of amentoflavone: A negative modulator at GABA(A) receptors. Bioorg Med Chem Lett. 2003 Jul 21;13(14):2281-4.
• [43] Whiting PJ: The GABAA receptor gene family: new opportunities for drug development. Curr Opin Drug Discov Devel. 2003 Sep;6(5):648-57.
• [44] Synthetic routes to 4-amino-3-carboxy-beta-carboline derivatives: incidental formation of novel furo[3,4-c]-beta-carbolin-2-ones displaying high af... J Med Chem. 1995 Jan 6;38(1):189-98.
• [45] Synthesis and benzodiazepine binding activity of a series of novel [1,2,4]triazolo[1,5-c]quinazolin-5(6H)-ones. J Med Chem. 1991 Jan;34(1):281-90.
• [46] 1,3-Diarylpyrazolo[4,5-c]- and -[5,4-c]quinolin-4-ones. 4. Synthesis and specific inhibition of benzodiazepine receptor binding. J Med Chem. 1987 Oct;30(10):1737-42.
• [47] 3-phenyl-6-(2-pyridyl)methyloxy-1,2,4-triazolo[3,4-a]phthalazines and analogues: high-affinity gamma-aminobutyric acid-A benzodiazepine receptor li... J Med Chem. 2004 Mar 25;47(7):1807-22.
• [48] Novel N-substituted indol-3-ylglyoxylamides probing the LDi and L1/L2 lipophilic regions of the benzodiazepine receptor site in search for subtype-... J Med Chem. 2007 Apr 5;50(7):1627-34.
• [49] Novel N-(arylalkyl)indol-3-ylglyoxylylamides targeted as ligands of the benzodiazepine receptor: synthesis, biological evaluation, and molecular mo... J Med Chem. 2001 Jul 5;44(14):2286-97.
• [50] Orally active and potent inhibitors of gamma-aminobutyric acid uptake. J Med Chem. 1985 May;28(5):653-60.
• [51] Synthesis and structure-activity relationships of a series of anxioselective pyrazolopyridine ester and amide anxiolytic agents. J Med Chem. 1989 Dec;32(12):2561-73.
• [52] Synthesis and interaction of 5-(substituted-phenyl)-3-methyl-6,7-dihydropyrazolo[4,3-e] [1,4]diazepin-8(7H)-ones with benzodiazepine receptors in r... J Med Chem. 1985 May;28(5):683-5.
• [53] Methods for drug discovery: development of potent, selective, orally effective cholecystokinin antagonists. J Med Chem. 1988 Dec;31(12):2235-46.
• [54] Synthesis and evaluation of imidazo[1,5-a][1,4]benzodiazepine esters with high affinities and selectivities at "diazepam-insensitive" benzodiazepin... J Med Chem. 1993 Apr 16;36(8):1001-6.
• [55] The discovery and unique pharmacological profile of RO4938581 and RO4882224 as potent and selective GABAA alpha5 inverse agonists for the treatment... Bioorg Med Chem Lett. 2009 Oct 15;19(20):5940-4.
• [56] Potential anxiolytic agents. Pyrido[1,2-a]benzimidazoles: a new structural class of ligands for the benzodiazepine binding site on GABA-A receptors. J Med Chem. 1995 Jan 6;38(1):16-20.
• [57] Predictive models for GABAA/benzodiazepine receptor subtypes: studies of quantitative structure-activity relationships for imidazobenzodiazepines a... J Med Chem. 1998 Oct 8;41(21):4130-42.
• [58] Antagonist, partial agonist, and full agonist imidazo[1,5-a]quinoxaline amides and carbamates acting through the GABAA/benzodiazepine receptor. J Med Chem. 1994 Mar 18;37(6):758-68.
• [59] Phosphinic acid analogues of GABA. 1. New potent and selective GABAB agonists. J Med Chem. 1995 Aug 18;38(17):3297-312.