Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTTIBOJ)

• DTT Name: Histamine H1 receptor (H1R)
• Synonyms: HH1R; H1R
• Gene Name: HRH1
• DTT Type: Successful target; [1]
• Related Disease:
  Allergic/hypersensitivity disorder [ICD-11: 4A80-4A8Z]
  Anxiety disorder [ICD-11: 6B00-6B0Z]
  Breathing abnormality [ICD-11: MD11]
  Conjunctiva disorder [ICD-11: 9A60]
  Cough [ICD-11: MD12]
  Depression [ICD-11: 6A70-6A7Z]
  Episodic vestibular syndrome [ICD-11: AB31]
  Headache [ICD-11: 8A80-8A84]
  Insomnia [ICD-11: 7A00-7A0Z]
  Morning sickness disorder [ICD-11: SC00]
  Nasopharyngitis [ICD-11: CA00]
  Nausea/vomiting [ICD-11: MD90]
  Parkinsonism [ICD-11: 8A00]
  Pruritus [ICD-11: EC90]
  Rheumatoid arthritis [ICD-11: FA20]
  Sleep-wake disorder [ICD-11: 7A00-7B2Z]
  Vasomotor/allergic rhinitis [ICD-11: CA08]
• BioChemical Class: GPCR rhodopsin
• UniProt ID: HRH1_HUMAN
• TTD ID: T77913
• Sequence:
  MSLPNSSCLLEDKMCEGNKTTMASPQLMPLVVVLSTICLVTVGLNLLVLYAVRSERKLHT
  VGNLYIVSLSVADLIVGAVVMPMNILYLLMSKWSLGRPLCLFWLSMDYVASTASIFSVFI
  LCIDRYRSVQQPLRYLKYRTKTRASATILGAWFLSFLWVIPILGWNHFMQQTSVRREDKC
  ETDFYDVTWFKVMTAIINFYLPTLLMLWFYAKIYKAVRQHCQHRELINRSLPSFSEIKLR
  PENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQEDDREVDKL
  YCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSR
  TDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQLGFI
  MAAFILCWIPYFIFFMVIAFCKNCCNEHLHMFTIWLGYINSTLNPLIYPLCNENFKKTFK
  RILHIRS
• Function: In peripheral tissues, the H1 subclass of histamine receptors mediates the contraction of smooth muscles, increase in capillary permeability due to contraction of terminal venules, and catecholamine release from adrenal medulla, as well as mediating neurotransmission in the central nervous system.
• KEGG Pathway:
  Calcium signaling pathway (hsa04020)
  Neuroactive ligand-receptor interaction (hsa04080)
  Inflammatory mediator regulation of TRP channels (hsa04750)
• Reactome Pathway:
  G alpha (q) signalling events (R-HSA-416476)
  Histamine receptors (R-HSA-390650)

Molecular Interaction Atlas (MIA) of This DTT

55 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
(S)-(+)-Dimethindene maleate	DMMHNU2	Pruritus	EC90	Approved	[2], [3], [4], [5]
Aceprometazine	DM1SRQT	Sleep-wake disorder	7A00-7B2Z	Approved	[6]
Acrivastine	DMTIGA0	Allergic rhinitis	CA08.0	Approved	[7], [8]
Alcaftadine	DM5J1NH	Allergic conjunctivitis	9A60.02	Approved	[9]
Antazoline	DMA04JS	Nasal congestion	MD11.9	Approved	[10], [11], [12], [8]
Azatadine	DMZ80SB	Allergic rhinitis	CA08.0	Approved	[13]
Azelastine	DMXTMBJ	Allergic conjunctivitis	9A60.02	Approved	[14], [15]
Bepotastine	DMXDZAQ	Allergic rhinitis	CA08.0	Approved	[16]
Bromodiphenhydramine	DMNDJT5	Hay fever	CA08.00	Approved	[17]
Brompheniramine	DMFOVSD	Allergic rhinitis	CA08.0	Approved	[18]
Buclizine	DMXKZT3	Nausea	MD90	Approved	[19]
Carbinoxamine	DMCT31R	Vasomotor/allergic rhinitis	CA08	Approved	[20]
Cetirizine	DMOMP9U	Allergic rhinitis	CA08.0	Approved	[21], [22]
Chlophedianol	DMXGJEI	Dry cough	MD12	Approved	[23]
Chlorpheniramine	DM5URA2	Allergic rhinitis	CA08.0	Approved	[14], [24], [5]
Cinnarizine	DM7U5QJ	Vertigo meniere disease	AB31.0	Approved	[25], [26]
Clemastine	DMBZWQL	Allergic rhinitis	CA08.0	Approved	[1], [27]
Cyclizine	DM9G7BS	Nausea	MD90	Approved	[28], [29], [30]
Cyproheptadine	DM92AH3	Rhinitis	FA20	Approved	[31], [32]
Desloratadine	DM56YN7	Allergic rhinitis	CA08.0	Approved	[33], [34]
Dexbrompheniramine	DMKVWGE	Hay fever	CA08.00	Approved	[35]
Dexchlorpheniramine maleate	DMA8DPN	Rhinitis	FA20	Approved	[36]
Dimenhydrinate	DM264B3	Nausea	MD90	Approved	[37], [38]
Dimethindene	DM32YAI	Respiratory allergy	4A80	Approved	[2], [3], [4], [5]
Diphenhydramine	DMKQTBA	Meniere disease	AB31.0	Approved	[14], [39]
Diphenylpyraline	DMW4X37	Allergic rhinitis	CA08.0	Approved	[40]
Doxepin	DMPI98T	Depression	6A70-6A7Z	Approved	[41], [42]
Doxylamine	DMKOXFE	Morning sickness	SC00	Approved	[43], [44]
Emedastine	DM36LAJ	Allergic conjunctivitis	9A60.02	Approved	[45]
Epinastine	DMX0K3Q	Allergic conjunctivitis	9A60.02	Approved	[46]
Ergotidine	DM78IME	Respiratory allergy	4A80	Approved	[47]
Ethopropazine	DM0N3L7	Parkinson disease	8A00.0	Approved	[36]
Fexofenadine	DM17ONX	Allergic rhinitis	CA08.0	Approved	[34], [22]
Hydroxyzine	DMF8Y74	Anxiety disorder	6B00-6B0Z	Approved	[48], [49]
Ketotifen	DMOVY05	Allergic conjunctivitis	9A60.02	Approved	[14], [50]
Levocabastine	DMMZPWT	Allergic conjunctivitis	9A60.02	Approved	[51], [52]
Levocetirizine dihydrochloride	DMW6ZJI	Allergic rhinitis	CA08.0	Approved	[34], [14], [50]
Loratadine	DMF3AN7	Allergy	4A80-4A85	Approved	[53], [54], [55]
Mepyramine	DMB4SFH	Allergy	4A80-4A85	Approved	[56], [57], [21]
Mepyramine maleate	DM7F5OW	Allergy	4A80-4A85	Approved	[56], [57], [21], [14], [5]
Mequitazine	DMAFBCY	Allergic rhinitis	CA08.0	Approved	[58]
Methdilazine	DMAUHQX	Allergic rhinitis	CA08.0	Approved	[59]
Mizolastine	DM1FDN8	Allergic rhinitis	CA08.0	Approved	[60]
Olopatadine	DMKMWQG	Allergic conjunctivitis	9A60.02	Approved	[61]
Oxatomide	DM1F42Z	Hay fever	CA08.00	Approved	[14], [52]
Pemirolast	DML97WV	Allergic conjunctivitis	9A60.02	Approved	[62]
Phenindamine	DMDTC7R	Common cold	CA00	Approved	[63]
Pheniramine	DMCH7RU	Hay fever	CA08.00	Approved	[64]
Promethazine	DM6I5GR	Nausea	MD90	Approved	[14], [5]
Propiomazine	DMKY8V1	Insomnia	7A00-7A0Z	Approved	[65]
Tranilast	DME5Y64	Ocular allergy	4A81	Approved	[61]
Trimeprazine	DMEMV9D	Allergic rhinitis	CA08.0	Approved	[66]
Tripelennamine	DMZBU15	Hypersensitivity	4A80-4A85	Approved	[67], [68], [69], [70]
Triprolidine	DM7SWIA	Hay fever	CA08.00	Approved	[71]
Rupatadine	DMBPN7T	N. A.	N. A.	Phase 4	[72]

9 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
AC-170	DMXZ9T3	Allergic conjunctivitis	9A60.02	Phase 3	[73]
Carebastine	DMUVMWZ	Ocular allergy	4A81	Phase 3	[61]
E-4716	DMC5PB2	Respiratory disease	CB40	Phase 2	[74]
LY-2624803	DMTPQUA	Insomnia	7A00-7A0Z	Phase 2	[75]
Noberastine	DME8IFQ	Asthma	CA23	Phase 2	[76]
OBE-101	DMJIBSG	Obesity	5B81	Phase 2	[77]
RP5063	DMKUE8O	Schizophrenia	6A20	Phase 2	[78]
UCB-35440	DM5Z34K	Rhinitis	FA20	Phase 2	[79]
Vapitadine	DMNFVKC	Allergic skin disorder	4A82	Phase 2	[80]

3 Patented Agent(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Citalopram derivative 1	DMITX1G	N. A.	N. A.	Patented	[81]
Piperidine derivative 1	DMHN5KW	N. A.	N. A.	Patented	[81]
PMID29334795-Compound-61	DM9H3LI	N. A.	N. A.	Patented	[81]

12 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Astemizole	DM2HN6Q	Allergic rhinitis	CA08.0	Withdrawn from market	[82], [10]
Terfenadine	DM4KLPT	Allergy	4A80-4A85	Withdrawn from market	[83], [54]
Norastemizole	DMXF0NS	N. A.	N. A.	Discontinued in Preregistration	[84]
GSK835726	DMRNJPY	Allergic rhinitis	CA08.0	Discontinued in Phase 2	[85]
HSR-609	DM1PJ0V	Rhinitis	FA20	Discontinued in Phase 2	[86], [87]
Mequitamium iodide	DM2DK4A	Asthma	CA23	Discontinued in Phase 2	[88]
ReN-1869	DMHCBQS	Pain	MG30-MG3Z	Discontinued in Phase 2	[89]
SUN-1334H	DMWTLQ4	Allergic rhinitis	CA08.0	Discontinued in Phase 2	[90]
AZD-1744	DMCOMG5	Asthma	CA23	Discontinued in Phase 1	[91]
GSK1004723	DMEC6RD	Allergic rhinitis	CA08.0	Discontinued in Phase 1	[85]
KA-398	DM0MXWC	Asthma	CA23	Terminated	[92]
Selenotifen	DM4ESAP	Asthma	CA23	Terminated	[93]

47 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
(+)-cis-H2-PAT	DMDFR59	Discovery agent	N.A.	Investigative	[94]
(+)-trans-H2-PAT	DMAN63P	Discovery agent	N.A.	Investigative	[94]
(+/-)-cis-H2-PAT	DMAHO9M	Discovery agent	N.A.	Investigative	[94]
(-)-trans-H2-PAT	DMITWZ7	Discovery agent	N.A.	Investigative	[94]
(S)-cetirizine	DMJN659	Discovery agent	N.A.	Investigative	[95]
1-(4-p-Tolyl-butyl)-piperidine	DMFYK6T	Discovery agent	N.A.	Investigative	[96]
1-[(Furan-2(5H)-one)-4-methyl]-desloratadine	DMQPFT3	Discovery agent	N.A.	Investigative	[97]
2-(2-thiazolyl)ethanamine	DMRL65E	Discovery agent	N.A.	Investigative	[98]
2-(3-bromophenyl)histamine	DM260RG	Discovery agent	N.A.	Investigative	[98]
2-(3-chlorophenyl)histamine	DMO0Y79	Discovery agent	N.A.	Investigative	[98]
2-(3-iodophenyl)histamine	DMML0VP	Discovery agent	N.A.	Investigative	[98]
2-(9,10-dihydroanthracen-9-yl)-N-methylethanamine	DMRW475	Discovery agent	N.A.	Investigative	[99]
2-pyridylethylamine	DMN516S	Discovery agent	N.A.	Investigative	[95]
3,3-diphenylpropan-1-amine	DMNOUSV	Discovery agent	N.A.	Investigative	[99]
4,4-Diphenylbutan-1-amine	DMQ0TBX	Discovery agent	N.A.	Investigative	[99]
4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one	DMM9X0G	Discovery agent	N.A.	Investigative	[100]
8R-Lisuride	DMLK4WO	Discovery agent	N.A.	Investigative	[101]
9-(2-aminoethyl)-9,10-dihydroanthracene	DM4Y9U3	Discovery agent	N.A.	Investigative	[99]
9-(2-aminopropyl)-9,10-dihydroanthracene	DMND39P	Discovery agent	N.A.	Investigative	[99]
9-(Aminomethyl)-9,10-dihydroanthracene	DM6QDNH	Discovery agent	N.A.	Investigative	[99]
9-OH-risperidone	DMGORXQ	Discovery agent	N.A.	Investigative	[102]
9-Phenyl-2,3-dihydro-1H-indeno[2,1-c]pyridine	DMRCM7Q	Discovery agent	N.A.	Investigative	[103]
arpromidine	DMB9PDA	Discovery agent	N.A.	Investigative	[98]
BU-E 47	DM1D47I	Discovery agent	N.A.	Investigative	[98]
DIMEBOLIN	DMV8ZQG	Discovery agent	N.A.	Investigative	[104]
dimethylhistaprodifen	DMY0FVU	Discovery agent	N.A.	Investigative	[98]
Diphenyl(piperidin-4-yl)methanol	DMO4XUC	Discovery agent	N.A.	Investigative	[96]
histaprodifen	DMA9YIB	Discovery agent	N.A.	Investigative	[105]
Hydroxyclemastine	DM5DOEC	Discovery agent	N.A.	Investigative	[1], [27]
impromidine	DMTDRPM	Discovery agent	N.A.	Investigative	[106]
KF-A6	DMQJ3T5	Discovery agent	N.A.	Investigative	[107]
MDL-28163	DMUHJ2C	Discovery agent	N.A.	Investigative	[72]
methylhistaprodifen	DM7PRDY	Discovery agent	N.A.	Investigative	[98]
N,N-dimethyl-2,2-diphenylethanamine	DMJDQGR	Discovery agent	N.A.	Investigative	[99]
N,N-Dimethyl-3,3-diphenylpropan-1-amine	DMIP5K7	Discovery agent	N.A.	Investigative	[99]
N,N-dimethyl-4,4-diphenylbutan-1-amine	DMX9U7S	Discovery agent	N.A.	Investigative	[99]
N-methyl-3,3-diphenylpropan-1-amine	DM8IHQP	Discovery agent	N.A.	Investigative	[99]
N-methyl-4,4-diphenylbutan-1-amine	DMO3PNF	Discovery agent	N.A.	Investigative	[99]
OCTOCLOTHEPIN	DM0UADK	Discovery agent	N.A.	Investigative	[108]
oxo-arpromidine	DMV0KTW	Discovery agent	N.A.	Investigative	[106]
R-226161	DM4BP7S	Discovery agent	N.A.	Investigative	[109]
R-dimethindene	DM6FVZW	Discovery agent	N.A.	Investigative	[110]
UR-PG131A	DM2C6GB	Discovery agent	N.A.	Investigative	[106]
UR-PG146	DMQCL6Y	Discovery agent	N.A.	Investigative	[106]
UR-PG153	DM3VTLG	Discovery agent	N.A.	Investigative	[106]
UR-PG55B	DM6SM4N	Discovery agent	N.A.	Investigative	[106]
VUF-10148	DM89PMC	Discovery agent	N.A.	Investigative	[111]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Major depressive disorder	6A20	Pre-frontal cortex	2.21E-01	-0.17	-0.25
Parkinson's disease	8A00.0	Substantia nigra tissue	6.74E-01	0.13	0.43
Sensitive skin	EA90	Skin	4.04E-01	0.06	0.17
Asthma	CA23	Nasal and bronchial airway	6.86E-09	0.3	0.55

References

• [1] Histamine upregulates keratinocyte MMP-9 production via the histamine H1 receptor. J Invest Dermatol. 2008 Dec;128(12):2783-91.
• [2] Analytical method for simultaneously measuring ex vivo drug receptor occupancy and dissociation rate: application to (R)-dimethindene occupancy of central histamine H1 receptors. J Recept Signal Transduct Res. 2009;29(2):84-93.
• [3] Prescription and safety of dimethindene maleate micropellet capsules in Hungary. Orv Hetil. 2004 Feb 15;145(7):327-9.
• [4] Effects of dimethindene maleate nasal spray on the quality of life in seasonal allergic rhinitis. Rhinology. 2003 Sep;41(3):159-66.
• [5] Inhibition by histamine H1 receptor antagonists of endogenous glibenclamide-sensitive K+ channels in follicle-enclosed Xenopus oocytes. Eur J Pharmacol. 1994 Jan 1;266(1):99-102.
• [6] Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34.
• [7] Clinical pharmacology of new histamine H1 receptor antagonists. Clin Pharmacokinet. 1999 May;36(5):329-52.
• [8] Nonsedating histamine H1-receptor antagonists. Clin Pharm. 1989 May;8(5):331-44.
• [9] Mullard A: 2010 FDA drug approvals. Nat Rev Drug Discov. 2011 Feb;10(2):82-5.
• [10] Histamine and the convulsive threshold or effectiveness of antiepileptic drugs. Przegl Lek. 2008;65(11):803-6.
• [11] Influence of antazoline and ketotifen on the anticonvulsant activity of conventional antiepileptics against maximal electroshock in mice. Eur Neuropsychopharmacol. 2004 Aug;14(4):307-18.
• [12] A current appreciation of sites for pharmacological intervention in allergic conjunctivitis: effects of new topical ocular drugs. Acta Ophthalmol Scand Suppl. 1999;(228):33-7.
• [13] Comparative effects of loratadine and azatadine in the treatment of seasonal allergic rhinitis. Asian Pac J Allergy Immunol. 1990 Dec;8(2):103-7.
• [14] Intact cell binding for in vitro prediction of sedative and non-sedative histamine H1-receptor antagonists based on receptor internalization. J Pharmacol Sci. 2008 May;107(1):66-79.
• [15] The in vivo potency and selectivity of azelastine as an H1 histamine-receptor antagonist in human airways and skin. J Allergy Clin Immunol. 1988 Dec;82(6):1113-8.
• [16] Mast cells play a critical role in the pathogenesis of viral myocarditis. Circulation. 2008 Jul 22;118(4):363-72.
• [17] Studies on synergism between penicillins and ambodryl (bromodiphenhydramine HCl), an antihistamine with antimicrobial property. Indian J Exp Biol. 1990 Mar;28(3):253-8.
• [18] Histamine-induced venodilation in human beings involves both H1 and H2 receptor subtypes. J Allergy Clin Immunol. 1994 Mar;93(3):606-14.
• [19] Toxicologic and clinical appraisal of buclizine, a new antihistaminic compound. J Allergy. 1956 Jan;27(1):63-7.
• [20] Comparison of the effects of eleven histamine H1-receptor antagonists on monoamine turnover in the mouse brain. Naunyn Schmiedebergs Arch Pharmacol. 1994 Feb;349(2):140-4.
• [21] Design, synthesis and histamine H1-receptor antagonistic activity of some novel 4-amino-2-(substituted)-5-(substituted) aryl-6-[(substituted aryl) amino] pyrimidines. Arzneimittelforschung. 2009;59(5):243-7.
• [22] Knockouts model the 100 best-selling drugs--will they model the next 100 Nat Rev Drug Discov. 2003 Jan;2(1):38-51.
• [23] Identification and differentiation of alkylamine antihistamines and their metabolites in urine by computerized gas chromatography-mass spectrometry. J Chromatogr. 1988 Aug 19;430(1):31-41.
• [24] Combined histamine H1 and H3 receptor blockade produces nasal decongestion in an experimental model of nasal congestion. Am J Rhinol. 1999 Sep-Oct;13(5):391-9.
• [25] Central effects of cinnarizine: restricted use in aircrew. Aviat Space Environ Med. 2002 Jun;73(6):570-4.
• [26] Effects of calcium-antagonistic drugs on the stimulation by carbamoylcholine and histamine of phosphatidylinositol turnover in longitudinal smooth muscle of guinea-pig ileum. Biochem J. 1976 Nov 15;160(2):163-9.
• [27] Stereoselective synthesis of (-)-hydroxyclemastine as a versatile intermediate for the H1 receptor antagonist clemastine. Arch Pharm Res. 2007 Dec;30(12):1521-5.
• [28] Histamine H1-receptor antagonists, promethazine and homochlorcyclizine, increase the steady-state plasma concentrations of haloperidol and reduced haloperidol. Ther Drug Monit. 2003 Apr;25(2):192-6.
• [29] Comparison of cyclizine and ondansetron for the prevention of postoperative nausea and vomiting in laparoscopic day-case gynaecological surgery. Anaesthesia. 2002 Jan;57(1):61-5.
• [30] Synthesis and combined H1-/H2 antagonist activity of mepyramine, pheniramine and cyclizine derivatives with cyanoguanidine, urea and nitroethenediamine partial structures. Arch Pharm (Weinheim). 1994Jul;327(7):455-62.
• [31] Cyproheptadine displays preclinical activity in myeloma and leukemia. Blood. 2008 Aug 1;112(3):760-9.
• [32] Antihistamines in the treatment of dermatitis. J Cutan Med Surg. 2003 Nov-Dec;7(6):467-73.
• [33] Examining the tolerability of the non-sedating antihistamine desloratadine: a prescription-event monitoring study in England. Drug Saf. 2009;32(2):169-79.
• [34] Update on prescription and over-the-counter histamine inverse agonists in rhinitis therapy. Curr Allergy Asthma Rep. 2009 Mar;9(2):140-8.
• [35] H2 histaminergic control of inhibition of eating induced by intragastric NaCl in rats. Physiol Behav. 1998 Aug;65(1):105-13.
• [36] Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
• [37] Histamine 1 receptor antagonist in symptomatic treatment of renal colic accompanied by nausea: two birds with one stone Urology. 2009 Jan;73(1):32-6.
• [38] Mechanisms and abuse liability of the anti-histamine dimenhydrinate. Neurosci Biobehav Rev. 2002 Jan;26(1):61-7.
• [39] Histamine as an autocrine regulator of leukemic cell proliferation. Leuk Lymphoma. 2000 Jan;36(3-4):367-73.
• [40] Transport mechanism of an H1-antagonist at the blood-brain barrier: transport mechanism of mepyramine using the carotid injection technique. Biol Pharm Bull. 1994 May;17(5):676-9.
• [41] Novel therapeutic usage of low-dose doxepin hydrochloride. Expert Opin Investig Drugs. 2007 Aug;16(8):1295-305.
• [42] Evaluation of in vivo selective binding of [11C]doxepin to histamine H1 receptors in five animal species. Nucl Med Biol. 2004 May;31(4):493-502.
• [43] First-generation H1 antihistamines found in pilot fatalities of civil aviation accidents, 1990-2005. Aviat Space Environ Med. 2007 May;78(5):514-22.
• [44] Steady-state brain concentrations of antihistamines in rats: interplay of membrane permeability, P-glycoprotein efflux and plasma protein binding. Pharmacology. 2004 Oct;72(2):92-8.
• [45] Emedastine difumarate: a review of its potential ameliorating effect for tissue remodeling in allergic diseases. Expert Opin Pharmacother. 2009 Aug;10(11):1859-67.
• [46] Influence of epinastine hydrochloride, an H1-receptor antagonist, on the function of mite allergen-pulsed murine bone marrow-derived dendritic cell... Mediators Inflamm. 2009;2009:738038.
• [47] Cloning and pharmacological characterization of a fourth histamine receptor (H(4)) expressed in bone marrow. Mol Pharmacol. 2001 Mar;59(3):420-6.
• [48] Hydroxyzine, a first generation H(1)-receptor antagonist, inhibits human ether-a-go-go-related gene (HERG) current and causes syncope in a patient ... J Pharmacol Sci. 2008 Dec;108(4):462-71.
• [49] Physicochemical, pharmacological and pharmacokinetic properties of the zwitterionic antihistamines cetirizine and levocetirizine. Curr Med Chem. 2008;15(21):2173-91.
• [50] Influence of chronic treatment with H1 receptor antagonists on the anticonvulsant activity of antiepileptic drugs. Pol J Pharmacol. 2001 Jan-Feb;53(1):93-6.
• [51] Contribution of alpha4beta1 integrin to the antiallergic effect of levocabastine. Biochem Pharmacol. 2008 Sep 15;76(6):751-62.
• [52] Effects of fexofenadine and other antihistamines on components of the allergic response: adhesion molecules. J Allergy Clin Immunol. 2003 Oct;112(4 Suppl):S78-82.
• [53] Clinical research of Ibudilast on treating the steroid resistant allergic rhinitis. Lin Chung Er Bi Yan Hou Tou Jing Wai Ke Za Zhi. 2009 Jan;23(2):63-6.
• [54] Second-generation antihistamines: a comparative review. Drugs. 1999 Jan;57(1):31-47.
• [55] Effect of descarboethoxyloratadine, the major metabolite of loratadine, on the human cardiac potassium channel Kv1.5. Br J Pharmacol. 1997 Nov;122(5):796-8.
• [56] Antinociception induced by central administration of histamine in the formalin test in rats. Indian J Physiol Pharmacol. 2008 Jul-Sep;52(3):249-54.
• [57] Receptor mediation and nociceptin inhibition of bradykinin-induced plasma extravasation in the knee joint of the rat. Inflamm Res. 2009 Dec;58(12):873-80.
• [58] Efficiency of mequitazine in the treatment of allergic rhinitis and chronic urticaria in children. A bibliographic systematic review. Rev Alerg Mex. 2008 Jan-Feb;55(1):3-9.
• [59] Effect of H1 blockers alone and in combination with morphine to produce antinociception in mice. Neuropharmacology. 1985 Jan;24(1):1-4.
• [60] Histamine H1-receptor antagonists inhibit nuclear factor-kappaB and activator protein-1 activities via H1-receptor-dependent and -independent mechanisms. Clin Exp Allergy. 2008 Jun;38(6):947-56.
• [61] Emerging drugs for ocular allergy. Expert Opin Emerg Drugs. 2005 Aug;10(3):505-20.
• [62] The effect of a combined therapy with a histamine H1 antagonist and a chemical mediator release inhibitor on allergic conjunctivitis. Ophthalmologica. 2008;222(4):232-9.
• [63] The histamine H1-receptor antagonist binding site. A stereoselective pharmacophoric model based upon (semi-)rigid H1-antagonists and including a known interaction site on the receptor. J Med Chem. 1995 Aug 18;38(17):3351-60.
• [64] Role of central histaminergic system in lorazepam withdrawal syndrome in rats. Pharmacol Biochem Behav. 2001 Apr;68(4):777-82.
• [65] How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
• [66] Effectiveness of alimemazine in controlling retching after Nissen fundoplication. J Pediatr Surg. 2005 Nov;40(11):1737-40.
• [67] Involvement of histamine H1 and H2 receptors in the regulation of STAT-1 phosphorylation: inverse agonism exhibited by the receptor antagonists. Int Immunopharmacol. 2005 Jul;5(7-8):1299-309.
• [68] Role of N-methyl-D-aspartate receptors in gastric mucosal blood flow induced by histamine. J Neurosci Res. 2004 Sep 1;77(5):730-8.
• [69] Prostaglandin E2 aggravates gastric mucosal injury induced by histamine in rats through EP1 receptors. Life Sci. 2003 Dec 19;74(5):629-41.
• [70] Histamine H1 and H2 receptor antagonists accelerate skin barrier repair and prevent epidermal hyperplasia induced by barrier disruption in a dry environment. J Invest Dermatol. 2001 Feb;116(2):261-5.
• [71] Histamine excites rat lateral vestibular nuclear neurons through activation of post-synaptic H2 receptors. Neurosci Lett. 2008 Dec 19;448(1):15-9.
• [72] Designed multiple ligands. An emerging drug discovery paradigm. J Med Chem. 2005 Oct 20;48(21):6523-43.
• [73] Clinical pipeline report, company report or official report of NicOx SA.
• [74] Population pharmacokinetics of epinastine, a histamine H1 receptor antagonist, in adults and children. Br J Clin Pharmacol. 2005 Jan;59(1):43-53.
• [75] Current Phase II investigational therapies for insomnia. Expert Opin Investig Drugs. 2015 Mar;24(3):401-11.
• [76] A double-blind placebo controlled dose response study of noberastine on histamine induced weal and flare. Eur J Clin Pharmacol. 1991;40(1):83-5.
• [77] Betahistine in the treatment of M ni re's disease. Neuropsychiatr Dis Treat. 2007 August; 3(4): 429-440.
• [78] Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
• [79] The effect of a novel, dual function histamine H1 receptor antagonist/5-lipoxygenase enzyme inhibitor on in vivo dermal inflammation and extravasat... Eur J Pharmacol. 2005 Jan 4;506(3):265-71.
• [80] Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800020866)
• [81] Progress in the development of histamine H3 receptor antagonists/inverse agonists: a patent review (2013-2017).Expert Opin Ther Pat. 2018 Mar;28(3):175-196.
• [82] Histamine H1 receptor induces cytosolic calcium increase and aquaporin translocation in human salivary gland cells. J Pharmacol Exp Ther. 2009 Aug;330(2):403-12.
• [83] Small mouse cholangiocytes proliferate in response to H1 histamine receptor stimulation by activation of the IP3/CaMK I/CREB pathway. Am J Physiol Cell Physiol. 2008 Aug;295(2):C499-513.
• [84] Effect of tecastemizole on pulmonary and cutaneous allergic inflammatory responses. Clin Exp Allergy. 2007 Jun;37(6):909-17.
• [85] Clinical pipeline report, company report or official report of GlaxoSmithKline (2009).
• [86] Studies on the novel antiallergic agent HSR-609: its penetration into the central nervous system in mice and guinea pigs and its selectivity for the histamine H1-receptor. Jpn J Pharmacol. 1997 Apr;73(4):291-8.
• [87] Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
• [88] High-affinity binding of mequitamium iodide (LG 30435) to muscarinic and histamine H1 receptors. Eur J Pharmacol. 1990 Jul 17;182(3):413-20.
• [89] ReN 1869, a novel tricyclic antihistamine, is active against neurogenic pain and inflammation. Eur J Pharmacol. 2002 Jan 18;435(1):43-57.
• [90] Preclinical efficacy and safety pharmacology of SUN-1334H, a potent orally active antihistamine agent. Drugs R D. 2008;9(2):93-112.
• [91] Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41.
• [92] URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 262).
• [93] Effect of BN 52256 and other mediator antagonists on ouabain-induced cardiac arrhythmia in a model of anaphylaxis in guinea-pigs. Pharmacol Res. 1992 Feb-Mar;25(2):173-80.
• [94] A novel phenylaminotetralin radioligand reveals a subpopulation of histamine H(1) receptors. J Pharmacol Exp Ther. 2002 Jul;302(1):328-36.
• [95] Large-scale overproduction, functional purification and ligand affinities of the His-tagged human histamine H1 receptor. Eur J Biochem. 2004 Jul;271(13):2636-46.
• [96] Structural determinants for histamine H(1) affinity, hERG affinity and QTc prolongation in a series of terfenadine analogs. Bioorg Med Chem Lett. 2009 Sep 1;19(17):5043-7.
• [97] Stereoselective synthesis of desloratadine derivatives as antagonist of histamine. Bioorg Med Chem. 2010 Feb 15;18(4):1626-32.
• [98] Multiple differences in agonist and antagonist pharmacology between human and guinea pig histamine H1-receptor. J Pharmacol Exp Ther. 2003 Jun;305(3):1104-15.
• [99] Synthesis, structure-affinity relationships, and modeling of AMDA analogs at 5-HT2A and H1 receptors: structural factors contributing to selectivity. Bioorg Med Chem. 2009 Sep 15;17(18):6496-504.
• [100] Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 rec... J Med Chem. 2010 Sep 9;53(17):6386-97.
• [101] 8R-lisuride is a potent stereospecific histamine H1-receptor partial agonist. Mol Pharmacol. 2004 Mar;65(3):538-49.
• [102] Risperidone compared with new and reference antipsychotic drugs: in vitro and in vivo receptor binding. Psychopharmacology (Berl). 1996 Mar;124(1-2):57-73.
• [103] Conformationally-restricted ligands for the histamine H1 receptor. Bioorg Med Chem Lett. 2000 Jun 5;10(11):1277-9.
• [104] Synthesis and biological activity of 5-styryl and 5-phenethyl-substituted 2,3,4,5-tetrahydro-1H-pyrido[4,3-b]indoles. Bioorg Med Chem Lett. 2010 Jan 1;20(1):78-82.
• [105] Evaluation of histamine H1-, H2-, and H3-receptor ligands at the human histamine H4 receptor: identification of 4-methylhistamine as the first pote... J Pharmacol Exp Ther. 2005 Sep;314(3):1310-21.
• [106] Probing ligand-specific histamine H1- and H2-receptor conformations with NG-acylated Imidazolylpropylguanidines. J Pharmacol Exp Ther. 2006 Apr;317(1):139-46.
• [107] Design, synthesis, and evaluation of 10-N-substituted acridones as novel chemosensitizers in Plasmodium falciparum. Antimicrob Agents Chemother. 2007 Nov;51(11):4133-40.
• [108] Exploring the neuroleptic substituent in octoclothepin: potential ligands for positron emission tomography with subnanomolar affinity for (1)-adre... J Med Chem. 2010 Oct 14;53(19):7021-34.
• [109] Tricyclic isoxazolines: identification of R226161 as a potential new antidepressant that combines potent serotonin reuptake inhibition and alpha2-a... Bioorg Med Chem. 2007 Jun 1;15(11):3649-60.
• [110] Characterization of novel selective H1-antihistamines for clinical evaluation in the treatment of insomnia. J Med Chem. 2009 Sep 10;52(17):5307-10.
• [111] Fragment based design of new H4 receptor-ligands with anti-inflammatory properties in vivo. J Med Chem. 2008 Apr 24;51(8):2457-67.