Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT1MFQ5U)

• DOT Name: Protein L-Myc (MYCL)
• Synonyms: Class E basic helix-loop-helix protein 38; bHLHe38; Protein L-Myc-1; V-myc myelocytomatosis viral oncogene homolog
• Gene Name: MYCL
• Related Disease:
  B-cell neoplasm
  Carcinoma
  Lung neoplasm
  Alzheimer disease
  Breast cancer
  Breast carcinoma
  Colorectal carcinoma
  Colorectal neoplasm
  Duchenne muscular dystrophy
  Esophageal squamous cell carcinoma
  Familial atypical multiple mole melanoma syndrome
  Hepatocellular carcinoma
  Immunodeficiency
  Isolated neonatal sclerosing cholangitis
  Kidney cancer
  Lymphoma
  Medulloblastoma
  Metastatic malignant neoplasm
  Mycosis fungoides
  Neoplasm
  Non-hodgkin lymphoma
  Obesity
  Oral cancer
  Ovarian cancer
  Pheochromocytoma
  Prostate cancer
  Prostate neoplasm
  Renal carcinoma
  Retinoblastoma
  Sezary syndrome
  Thyroid tumor
  Lung adenocarcinoma
  Lung carcinoma
  Nasopharyngeal carcinoma
  Sarcoma
  Small lymphocytic lymphoma
  Soft tissue sarcoma
  Squamous cell carcinoma
  Lung cancer
  Advanced cancer
  Neuroblastoma
  Small-cell lung cancer
• UniProt ID: MYCL_HUMAN
• Pfam ID: PF00010 ; PF01056
• Sequence:
  MDYDSYQHYFYDYDCGEDFYRSTAPSEDIWKKFELVPSPPTSPPWGLGPGAGDPAPGIGP
  PEPWPGGCTGDEAESRGHSKGWGRNYASIIRRDCMWSGFSARERLERAVSDRLAPGAPRG
  NPPKASAAPDCTPSLEAGNPAPAAPCPLGEPKTQACSGSESPSDSENEEIDVVTVEKRQS
  LGIRKPVTITVRADPLDPCMKHFHISIHQQQHNYAARFPPESCSQEEASERGPQEEVLER
  DAAGEKEDEEDEEIVSPPPVESEAAQSCHPKPVSSDTEDVTKRKNHNFLERKRRNDLRSR
  FLALRDQVPTLASCSKAPKVVILSKALEYLQALVGAEKRMATEKRQLRCRQQQLQKRIAY
  LTGY

Molecular Interaction Atlas (MIA) of This DOT

42 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
B-cell neoplasm	DISVY326	Definitive	Biomarker	[1]
Carcinoma	DISH9F1N	Definitive	Biomarker	[2]
Lung neoplasm	DISVARNB	Definitive	Genetic Variation	[3]
Alzheimer disease	DISF8S70	Strong	Genetic Variation	[4]
Breast cancer	DIS7DPX1	Strong	Genetic Variation	[5]
Breast carcinoma	DIS2UE88	Strong	Genetic Variation	[5]
Colorectal carcinoma	DIS5PYL0	Strong	Genetic Variation	[6]
Colorectal neoplasm	DISR1UCN	Strong	Genetic Variation	[7]
Duchenne muscular dystrophy	DISRQ3NV	Strong	Genetic Variation	[8]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Biomarker	[9]
Familial atypical multiple mole melanoma syndrome	DIS2YEKP	Strong	Genetic Variation	[10]
Hepatocellular carcinoma	DIS0J828	Strong	Genetic Variation	[11]
Immunodeficiency	DIS093I0	Strong	Biomarker	[12]
Isolated neonatal sclerosing cholangitis	DIS6G5UY	Strong	Biomarker	[13]
Kidney cancer	DISBIPKM	Strong	Genetic Variation	[14]
Lymphoma	DISN6V4S	Strong	Biomarker	[15]
Medulloblastoma	DISZD2ZL	Strong	Biomarker	[16]
Metastatic malignant neoplasm	DIS86UK6	Strong	Biomarker	[17]
Mycosis fungoides	DIS62RB8	Strong	Biomarker	[18]
Neoplasm	DISZKGEW	Strong	Biomarker	[19]
Non-hodgkin lymphoma	DISS2Y8A	Strong	Genetic Variation	[20]
Obesity	DIS47Y1K	Strong	Biomarker	[21]
Oral cancer	DISLD42D	Strong	Genetic Variation	[22]
Ovarian cancer	DISZJHAP	Strong	Altered Expression	[23]
Pheochromocytoma	DIS56IFV	Strong	Genetic Variation	[24]
Prostate cancer	DISF190Y	Strong	Biomarker	[25]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[25]
Renal carcinoma	DISER9XT	Strong	Genetic Variation	[14]
Retinoblastoma	DISVPNPB	Strong	Biomarker	[26]
Sezary syndrome	DISFMTC7	Strong	Genetic Variation	[18]
Thyroid tumor	DISLVKMD	Strong	Genetic Variation	[27]
Lung adenocarcinoma	DISD51WR	moderate	Genetic Variation	[28]
Lung carcinoma	DISTR26C	moderate	Genetic Variation	[29]
Nasopharyngeal carcinoma	DISAOTQ0	moderate	Biomarker	[30]
Sarcoma	DISZDG3U	moderate	Genetic Variation	[31]
Small lymphocytic lymphoma	DIS30POX	moderate	Biomarker	[15]
Soft tissue sarcoma	DISSN8XB	moderate	Genetic Variation	[31]
Squamous cell carcinoma	DISQVIFL	moderate	Genetic Variation	[32]
Lung cancer	DISCM4YA	Disputed	Genetic Variation	[29]
Advanced cancer	DISAT1Z9	Limited	Biomarker	[33]
Neuroblastoma	DISVZBI4	Limited	Biomarker	[34]
Small-cell lung cancer	DISK3LZD	Limited	Altered Expression	[35]

16 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Protein L-Myc (MYCL).	[36]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Protein L-Myc (MYCL).	[37]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Protein L-Myc (MYCL).	[38]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Protein L-Myc (MYCL).	[39]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Protein L-Myc (MYCL).	[40]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Protein L-Myc (MYCL).	[41]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Protein L-Myc (MYCL).	[42]
Hydroquinone	DM6AVR4	Approved	Hydroquinone decreases the expression of Protein L-Myc (MYCL).	[43]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Protein L-Myc (MYCL).	[44]
Seocalcitol	DMKL9QO	Phase 3	Seocalcitol increases the expression of Protein L-Myc (MYCL).	[45]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Protein L-Myc (MYCL).	[47]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Protein L-Myc (MYCL).	[48]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Protein L-Myc (MYCL).	[49]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Protein L-Myc (MYCL).	[50]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Protein L-Myc (MYCL).	[51]
I-BET151	DMYRUH2	Investigative	I-BET151 decreases the expression of Protein L-Myc (MYCL).	[52]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Protein L-Myc (MYCL).	[46]

References

• [1] Cyclin D1/bcl-1 cooperates with myc genes in the generation of B-cell lymphoma in transgenic mice.EMBO J. 1994 Aug 1;13(15):3487-95. doi: 10.1002/j.1460-2075.1994.tb06655.x.
• [2] Microsatellite instability in multifocal urothelial carcinoma and effect on BAX and AXIN2.Can J Urol. 2003 Oct;10(5):2000-6.
• [3] Ethnic differences in frequencies of gene polymorphisms in the MYCL1 region and modulation of lung cancer patients' survival.Lung Cancer. 2007 Mar;55(3):271-7. doi: 10.1016/j.lungcan.2006.10.023. Epub 2006 Dec 4.
• [4] Lymphoblast-derived integration-free iPSC line AD-TREM2-1 from a 67year-old Alzheimer's disease patient expressing the TREM2 p.R47H variant.Stem Cell Res. 2018 May;29:60-63. doi: 10.1016/j.scr.2018.03.011. Epub 2018 Mar 20.
• [5] MicroRNA related polymorphisms and breast cancer risk.PLoS One. 2014 Nov 12;9(11):e109973. doi: 10.1371/journal.pone.0109973. eCollection 2014.
• [6] Elevated Microsatellite Alterations at Selected Tetranucleotide Repeats (EMAST) and Microsatellite Instability in Patients with Colorectal Cancer and Its Clinical Features.Curr Mol Med. 2016;16(9):829-839. doi: 10.2174/1566524016666161124103020.
• [7] Allelic loss of a common microsatellite marker MYCL1: a useful prognostic factor of poor outcomes in colorectal cancer.Clin Cancer Res. 2004 Mar 1;10(5):1758-63. doi: 10.1158/1078-0432.ccr-0779-3.
• [8] Establishment of a Duchenne muscular dystrophy patient-derived induced pluripotent stem cell line carrying a deletion of exons 51-53 of the dystrophin gene (CCMi003-A).Stem Cell Res. 2019 Oct;40:101544. doi: 10.1016/j.scr.2019.101544. Epub 2019 Aug 20.
• [9] Genetic polymorphisms and susceptibility to esophageal cancer among Chinese population (review).Oncol Rep. 2003 Sep-Oct;10(5):1615-23.
• [10] Exclusion of the familial melanoma locus (MLM) from the PND/D1S47 and MYCL1 regions of chromosome arm 1p in 7 Australian pedigrees.Genomics. 1992 Jan;12(1):18-25. doi: 10.1016/0888-7543(92)90401-d.
• [11] An early lesion in hepatic carcinogenesis: loss of heterozygosity in human cirrhotic livers and dysplastic nodules at the 1p36-p34 region.Hepatology. 2001 Jun;33(6):1415-24. doi: 10.1053/jhep.2001.24751.
• [12] L-MYC Expression Maintains Self-Renewal and Prolongs Multipotency ofPrimary Human Neural Stem Cells.Stem Cell Reports. 2016 Sep 13;7(3):483-495. doi: 10.1016/j.stemcr.2016.07.013. Epub 2016 Aug 18.
• [13] Long-term stability and computational analysis of migration patterns of L-MYC immortalized neural stem cells in the brain.PLoS One. 2018 Aug 2;13(8):e0199967. doi: 10.1371/journal.pone.0199967. eCollection 2018.
• [14] L-MYC allelotype in renal cell carcinoma.Cancer Genet Cytogenet. 1996 May;88(1):66-8. doi: 10.1016/0165-4608(95)00275-8.
• [15] B-cell activating factor and v-Myc myelocytomatosis viral oncogene homolog (c-Myc) influence progression of chronic lymphocytic leukemia.Proc Natl Acad Sci U S A. 2010 Nov 2;107(44):18956-60. doi: 10.1073/pnas.1013420107. Epub 2010 Oct 18.
• [16] MYC family amplification and clinical risk-factors interact to predict an extremely poor prognosis in childhood medulloblastoma.Acta Neuropathol. 2012 Apr;123(4):501-13. doi: 10.1007/s00401-011-0923-y. Epub 2011 Dec 3.
• [17] Gene amplification and gene dosage in cell lines derived from squamous cell carcinoma of the head and neck.Genes Chromosomes Cancer. 1991 Nov;3(6):443-54. doi: 10.1002/gcc.2870030606.
• [18] Amplification and overexpression of JUNB is associated with primary cutaneous T-cell lymphomas.Blood. 2003 Feb 15;101(4):1513-9. doi: 10.1182/blood-2002-08-2434. Epub 2002 Oct 3.
• [19] Microsatellite alterations at selected tetranucleotide repeats are associated with morphologies of colorectal neoplasias.Gastroenterology. 2010 Nov;139(5):1519-25. doi: 10.1053/j.gastro.2010.08.001. Epub 2010 Aug 11.
• [20] Restriction fragment length polymorphism of the L-myc oncogene in non-Hodgkin's lymphoma patients from India.Cancer Lett. 1998 Mar 13;125(1-2):165-9. doi: 10.1016/s0304-3835(97)00509-0.
• [21] Reprogrammed Functional Brown Adipocytes Ameliorate Insulin Resistance and Dyslipidemia in Diet-Induced Obesity and Type 2 Diabetes.Stem Cell Reports. 2015 Oct 13;5(4):569-81. doi: 10.1016/j.stemcr.2015.08.007. Epub 2015 Sep 10.
• [22] Restriction fragment length polymorphism of the L-myc gene in oral cancer patients.Br J Cancer. 1990 Apr;61(4):530-3. doi: 10.1038/bjc.1990.119.
• [23] Amplification and overexpression of the L-MYC proto-oncogene in ovarian carcinomas.Am J Pathol. 2003 May;162(5):1603-10. doi: 10.1016/S0002-9440(10)64294-0.
• [24] Consistent association of 1p loss of heterozygosity with pheochromocytomas from patients with multiple endocrine neoplasia type 2 syndromes.Cancer Res. 1992 Feb 15;52(4):770-4.
• [25] Spatial genomic heterogeneity within localized, multifocal prostate cancer.Nat Genet. 2015 Jul;47(7):736-45. doi: 10.1038/ng.3315. Epub 2015 May 25.
• [26] Functional analysis at the Cys706 residue of the retinoblastoma protein.J Biol Chem. 1992 Dec 25;267(36):25998-6003.
• [27] L-myc gene polymorphism and risk of thyroid cancer.Exp Oncol. 2008 Jun;30(2):117-20.
• [28] A new polymorphism (Ser362Thr) of the L-myc gene is not associated with lung adenocarcinoma risk and prognosis.Eur J Cancer Prev. 2004 Feb;13(1):87-9. doi: 10.1097/00008469-200402000-00014.
• [29] Polymorphisms of microRNA sequences or binding sites and lung cancer: a meta-analysis and systematic review.PLoS One. 2013 Apr 16;8(4):e61008. doi: 10.1371/journal.pone.0061008. Print 2013.
• [30] Genome wide detection of oncogene amplifications in nasopharyngeal carcinoma by array based comparative genomic hybridization.Int J Oncol. 2002 Mar;20(3):467-73.
• [31] Elevated frequency of a specific allele of the L-myc gene in male patients with bone and soft-tissue sarcomas.Int J Cancer. 1990 Jan 15;45(1):47-9. doi: 10.1002/ijc.2910450110.
• [32] Role of L-MYC polymorphism in oral squamous cell carcinoma in Turkey.Anticancer Res. 2009 Jul;29(7):2519-24.
• [33] Pathogenesis and therapeutic targeting of aberrant MYC expression in haematological cancers.Br J Haematol. 2017 Dec;179(5):724-738. doi: 10.1111/bjh.14917. Epub 2017 Nov 24.
• [34] Molecular evaluation of abnormalities of the short arm of chromosome 1 in neuroblastoma.Genes Chromosomes Cancer. 1990 Jul;2(2):137-46. doi: 10.1002/gcc.2870020210.
• [35] Myc-induced glutaminolysis bypasses HIF-driven glycolysis in hypoxic small cell lung carcinoma cells.Oncotarget. 2017 Jul 25;8(30):48983-48995. doi: 10.18632/oncotarget.16904.
• [36] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [37] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [38] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [39] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [40] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [41] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [42] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [43] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [44] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [45] Expression profiling in squamous carcinoma cells reveals pleiotropic effects of vitamin D3 analog EB1089 signaling on cell proliferation, differentiation, and immune system regulation. Mol Endocrinol. 2002 Jun;16(6):1243-56.
• [46] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [47] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [48] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [49] Global gene expression analysis reveals novel transcription factors associated with long-term low-level exposure of EA.hy926 human endothelial cells to bisphenol A. Chem Biol Interact. 2023 Aug 25;381:110571. doi: 10.1016/j.cbi.2023.110571. Epub 2023 May 25.
• [50] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [51] Cystathionine metabolic enzymes play a role in the inflammation resolution of human keratinocytes in response to sub-cytotoxic formaldehyde exposure. Toxicol Appl Pharmacol. 2016 Nov 1;310:185-194.
• [52] Antimyeloma activity of bromodomain inhibitors on the human myeloma cell line U266 by downregulation of MYCL. Anticancer Drugs. 2016 Sep;27(8):756-65. doi: 10.1097/CAD.0000000000000389.