Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT24GP9B)

DOT Name	E3 ubiquitin-protein ligase XIAP
Synonyms	EC 2.3.2.27; Baculoviral IAP repeat-containing protein 4; IAP-like protein; ILP; hILP; Inhibitor of apoptosis protein 3; IAP-3; hIAP-3; hIAP3; RING-type E3 ubiquitin transferase XIAP; X-linked inhibitor of apoptosis protein; X-linked IAP
Gene Name	XIAP
Related Disease	XIAP deficiency ( )
UniProt ID	XIAP_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	1C9Q ; 1F9X ; 1G3F ; 1G73 ; 1I3O ; 1I4O ; 1I51 ; 1KMC ; 1NW9 ; 1TFQ ; 1TFT ; 2ECG ; 2JK7 ; 2KNA ; 2OPY ; 2OPZ ; 2POI ; 2POP ; 2QRA ; 2VSL ; 3CLX ; 3CM2 ; 3CM7 ; 3EYL ; 3G76 ; 3HL5 ; 3UW4 ; 3UW5 ; 4EC4 ; 4HY0 ; 4IC2 ; 4IC3 ; 4J3Y ; 4J44 ; 4J45 ; 4J46 ; 4J47 ; 4J48 ; 4KJU ; 4KJV ; 4KMP ; 4MTZ ; 4OXC ; 4WVS ; 4WVT ; 4WVU ; 5C0K ; 5C0L ; 5C3H ; 5C3K ; 5C7A ; 5C7B ; 5C7C ; 5C7D ; 5C83 ; 5C84 ; 5M6E ; 5M6F ; 5M6H ; 5M6L ; 5M6M ; 5O6T ; 5OQW ; 6EY2 ; 6GJW ; 6QCI ; 8AZA ; 8GH7 ; 8W59 ; 8W5A
EC Number	2.3.2.27
Pfam ID	PF00653 ; PF21290 ; PF13920
Sequence	MTFNSFEGSKTCVPADINKEEEFVEEFNRLKTFANFPSGSPVSASTLARAGFLYTGEGDT VRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYLENSATQSTNSGIQNGQYKVENY LGSRDHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLT PRELASAGLYYTGIGDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNLNIRSE SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKC FHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTTEKTP SLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKD SMQDESSQTSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDK CPMCYTVITFKQKIFMS
Function	Multi-functional protein which regulates not only caspases and apoptosis, but also modulates inflammatory signaling and immunity, copper homeostasis, mitogenic kinase signaling, cell proliferation, as well as cell invasion and metastasis. Acts as a direct caspase inhibitor. Directly bind to the active site pocket of CASP3 and CASP7 and obstructs substrate entry. Inactivates CASP9 by keeping it in a monomeric, inactive state. Acts as an E3 ubiquitin-protein ligase regulating NF-kappa-B signaling and the target proteins for its E3 ubiquitin-protein ligase activity include: RIPK1, RIPK2, MAP3K2/MEKK2, DIABLO/SMAC, AIFM1, CCS, PTEN and BIRC5/survivin. Acts as an important regulator of innate immunity by mediating 'Lys-63'-linked polyubiquitination of RIPK2 downstream of NOD1 and NOD2, thereby transforming RIPK2 into a scaffolding protein for downstream effectors, ultimately leading to activation of the NF-kappa-B and MAP kinases signaling. 'Lys-63'-linked polyubiquitination of RIPK2 also promotes recruitment of the LUBAC complex to RIPK2. Regulates the BMP signaling pathway and the SMAD and MAP3K7/TAK1 dependent pathways leading to NF-kappa-B and JNK activation. Ubiquitination of CCS leads to enhancement of its chaperone activity toward its physiologic target, SOD1, rather than proteasomal degradation. Ubiquitination of MAP3K2/MEKK2 and AIFM1 does not lead to proteasomal degradation. Plays a role in copper homeostasis by ubiquitinating COMMD1 and promoting its proteasomal degradation. Can also function as E3 ubiquitin-protein ligase of the NEDD8 conjugation pathway, targeting effector caspases for neddylation and inactivation. Ubiquitinates and therefore mediates the proteasomal degradation of BCL2 in response to apoptosis. Protects cells from spontaneous formation of the ripoptosome, a large multi-protein complex that has the capability to kill cancer cells in a caspase-dependent and caspase-independent manner. Suppresses ripoptosome formation by ubiquitinating RIPK1 and CASP8. Acts as a positive regulator of Wnt signaling and ubiquitinates TLE1, TLE2, TLE3, TLE4 and AES. Ubiquitination of TLE3 results in inhibition of its interaction with TCF7L2/TCF4 thereby allowing efficient recruitment and binding of the transcriptional coactivator beta-catenin to TCF7L2/TCF4 that is required to initiate a Wnt-specific transcriptional program.
Tissue Specificity	Expressed in colonic crypts (at protein level) . Ubiquitous, except peripheral blood leukocytes .
KEGG Pathway	Platinum drug resistance (hsa01524 ) NF-kappa B sig.ling pathway (hsa04064 ) Ubiquitin mediated proteolysis (hsa04120 ) Apoptosis (hsa04210 ) Apoptosis - multiple species (hsa04215 ) Necroptosis (hsa04217 ) Focal adhesion (hsa04510 ) NOD-like receptor sig.ling pathway (hsa04621 ) TNF sig.ling pathway (hsa04668 ) Toxoplasmosis (hsa05145 ) Human T-cell leukemia virus 1 infection (hsa05166 ) Pathways in cancer (hsa05200 ) Chemical carcinogenesis - receptor activation (hsa05207 ) Small cell lung cancer (hsa05222 )
Reactome Pathway	SMAC (DIABLO) binds to IAPs (R-HSA-111463 ) SMAC(DIABLO)-mediated dissociation of IAP (R-HSA-111464 ) SMAC, XIAP-regulated apoptotic response (R-HSA-111469 ) Deactivation of the beta-catenin transactivating complex (R-HSA-3769402 ) RIPK1-mediated regulated necrosis (R-HSA-5213460 ) TNFR1-induced proapoptotic signaling (R-HSA-5357786 ) Regulation of TNFR1 signaling (R-HSA-5357905 ) TNFR1-induced NF-kappa-B signaling pathway (R-HSA-5357956 ) Regulation of necroptotic cell death (R-HSA-5675482 ) Regulation of PTEN localization (R-HSA-8948747 ) Regulation of PTEN stability and activity (R-HSA-8948751 ) Regulation of the apoptosome activity (R-HSA-9627069 ) Activation of caspases through apoptosome-mediated cleavage (R-HSA-111459 )

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
XIAP deficiency	DIS24CGE	Strong	X-linked	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

This DOT Affected the Drug Response of 8 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Cytarabine	DMZD5QR	Approved	E3 ubiquitin-protein ligase XIAP increases the response to substance of Cytarabine.	[95]
Mitomycin	DMH0ZJE	Approved	E3 ubiquitin-protein ligase XIAP affects the response to substance of Mitomycin.	[96]
Gemcitabine	DMSE3I7	Approved	E3 ubiquitin-protein ligase XIAP affects the response to substance of Gemcitabine.	[97]
Aclarubicin	DMLFZHD	Approved	E3 ubiquitin-protein ligase XIAP increases the response to substance of Aclarubicin.	[95]
Camptothecin	DM6CHNJ	Phase 3	E3 ubiquitin-protein ligase XIAP decreases the response to substance of Camptothecin.	[98]
Pyrazoloacridine	DMSOPAU	Phase 2	E3 ubiquitin-protein ligase XIAP increases the response to substance of Pyrazoloacridine.	[95]
Mitoflaxone	DMO06JV	Terminated	E3 ubiquitin-protein ligase XIAP increases the response to substance of Mitoflaxone.	[95]
ODQ	DMSAJO8	Investigative	E3 ubiquitin-protein ligase XIAP decreases the activity of ODQ.	[99]
------------------------------------------------------------------------------------


⏷ Show the Full List of 8 Drug(s)

93 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of E3 ubiquitin-protein ligase XIAP.	[2]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of E3 ubiquitin-protein ligase XIAP.	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of E3 ubiquitin-protein ligase XIAP.	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of E3 ubiquitin-protein ligase XIAP.	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of E3 ubiquitin-protein ligase XIAP.	[6]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of E3 ubiquitin-protein ligase XIAP.	[7]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of E3 ubiquitin-protein ligase XIAP.	[8]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of E3 ubiquitin-protein ligase XIAP.	[9]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of E3 ubiquitin-protein ligase XIAP.	[10]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of E3 ubiquitin-protein ligase XIAP.	[11]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of E3 ubiquitin-protein ligase XIAP.	[12]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of E3 ubiquitin-protein ligase XIAP.	[13]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of E3 ubiquitin-protein ligase XIAP.	[14]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of E3 ubiquitin-protein ligase XIAP.	[15]
Decitabine	DMQL8XJ	Approved	Decitabine decreases the expression of E3 ubiquitin-protein ligase XIAP.	[16]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of E3 ubiquitin-protein ligase XIAP.	[17]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil decreases the expression of E3 ubiquitin-protein ligase XIAP.	[18]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of E3 ubiquitin-protein ligase XIAP.	[19]
Niclosamide	DMJAGXQ	Approved	Niclosamide decreases the expression of E3 ubiquitin-protein ligase XIAP.	[20]
Cannabidiol	DM0659E	Approved	Cannabidiol decreases the expression of E3 ubiquitin-protein ligase XIAP.	[21]
Bortezomib	DMNO38U	Approved	Bortezomib increases the expression of E3 ubiquitin-protein ligase XIAP.	[22]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone decreases the expression of E3 ubiquitin-protein ligase XIAP.	[23]
Aspirin	DM672AH	Approved	Aspirin decreases the expression of E3 ubiquitin-protein ligase XIAP.	[24]
Paclitaxel	DMLB81S	Approved	Paclitaxel decreases the expression of E3 ubiquitin-protein ligase XIAP.	[25]
Diclofenac	DMPIHLS	Approved	Diclofenac affects the expression of E3 ubiquitin-protein ligase XIAP.	[15]
Nicotine	DMWX5CO	Approved	Nicotine increases the expression of E3 ubiquitin-protein ligase XIAP.	[26]
Menthol	DMG2KW7	Approved	Menthol increases the expression of E3 ubiquitin-protein ligase XIAP.	[27]
Rifampicin	DM5DSFZ	Approved	Rifampicin increases the expression of E3 ubiquitin-protein ligase XIAP.	[28]
Mitoxantrone	DMM39BF	Approved	Mitoxantrone decreases the expression of E3 ubiquitin-protein ligase XIAP.	[29]
Thalidomide	DM70BU5	Approved	Thalidomide decreases the expression of E3 ubiquitin-protein ligase XIAP.	[30]
Sorafenib	DMS8IFC	Approved	Sorafenib decreases the expression of E3 ubiquitin-protein ligase XIAP.	[31]
Estrone	DM5T6US	Approved	Estrone increases the expression of E3 ubiquitin-protein ligase XIAP.	[32]
Dactinomycin	DM2YGNW	Approved	Dactinomycin decreases the expression of E3 ubiquitin-protein ligase XIAP.	[33]
Docetaxel	DMDI269	Approved	Docetaxel decreases the expression of E3 ubiquitin-protein ligase XIAP.	[34]
Nitric Oxide	DM1RBYG	Approved	Nitric Oxide decreases the expression of E3 ubiquitin-protein ligase XIAP.	[35]
Testosterone Undecanoate	DMZO10Y	Approved	Testosterone Undecanoate decreases the expression of E3 ubiquitin-protein ligase XIAP.	[36]
Crizotinib	DM4F29C	Approved	Crizotinib decreases the expression of E3 ubiquitin-protein ligase XIAP.	[37]
Cantharidin	DMBP5N3	Approved	Cantharidin decreases the expression of E3 ubiquitin-protein ligase XIAP.	[38]
Trovafloxacin	DM6AN32	Approved	Trovafloxacin decreases the expression of E3 ubiquitin-protein ligase XIAP.	[39]
Bendamustine hydrochloride	DMFH15Z	Approved	Bendamustine hydrochloride decreases the expression of E3 ubiquitin-protein ligase XIAP.	[40]
Regorafenib	DMHSY1I	Approved	Regorafenib decreases the expression of E3 ubiquitin-protein ligase XIAP.	[41]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of E3 ubiquitin-protein ligase XIAP.	[42]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate decreases the expression of E3 ubiquitin-protein ligase XIAP.	[43]
Curcumin	DMQPH29	Phase 3	Curcumin decreases the expression of E3 ubiquitin-protein ligase XIAP.	[44]
Fenretinide	DMRD5SP	Phase 3	Fenretinide decreases the expression of E3 ubiquitin-protein ligase XIAP.	[45]
HMPL-004	DM29XGY	Phase 3	HMPL-004 decreases the expression of E3 ubiquitin-protein ligase XIAP.	[46]
I3C	DMIGFOR	Phase 3	I3C decreases the expression of E3 ubiquitin-protein ligase XIAP.	[47]
Buparlisib	DM1WEHC	Phase 3	Buparlisib decreases the expression of E3 ubiquitin-protein ligase XIAP.	[48]
Rebamipide	DM2GHCR	Phase 3	Rebamipide increases the expression of E3 ubiquitin-protein ligase XIAP.	[49]
Peretinoin	DMESAZK	Phase 3	Peretinoin decreases the expression of E3 ubiquitin-protein ligase XIAP.	[50]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of E3 ubiquitin-protein ligase XIAP.	[51]
PEITC	DMOMN31	Phase 2	PEITC decreases the expression of E3 ubiquitin-protein ligase XIAP.	[52]
Flavopiridol	DMKSUOI	Phase 2	Flavopiridol decreases the expression of E3 ubiquitin-protein ligase XIAP.	[53]
R-roscovitine	DMSH108	Phase 2	R-roscovitine decreases the expression of E3 ubiquitin-protein ligase XIAP.	[54]
UCN-01	DMUNJZB	Phase 2	UCN-01 decreases the expression of E3 ubiquitin-protein ligase XIAP.	[55]
STX-140	DMJK5CT	Phase 2	STX-140 decreases the expression of E3 ubiquitin-protein ligase XIAP.	[56]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of E3 ubiquitin-protein ligase XIAP.	[59]
LY294002	DMY1AFS	Phase 1	LY294002 decreases the expression of E3 ubiquitin-protein ligase XIAP.	[60]
Metastat	DMTQ4PN	Phase 1	Metastat decreases the expression of E3 ubiquitin-protein ligase XIAP.	[34]
VS-5584	DMMO3G5	Phase 1	VS-5584 decreases the expression of E3 ubiquitin-protein ligase XIAP.	[61]
EMD-534085	DMQ6YAZ	Phase 1	EMD-534085 decreases the expression of E3 ubiquitin-protein ligase XIAP.	[62]
PMID28870136-Compound-48	DMPIM9L	Patented	PMID28870136-Compound-48 increases the expression of E3 ubiquitin-protein ligase XIAP.	[63]
Steroid derivative 1	DMB0NVQ	Patented	Steroid derivative 1 decreases the expression of E3 ubiquitin-protein ligase XIAP.	[25]
PMID26560530-Compound-35	DMO36RL	Patented	PMID26560530-Compound-35 decreases the expression of E3 ubiquitin-protein ligase XIAP.	[64]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of E3 ubiquitin-protein ligase XIAP.	[66]
Ciglitazone	DMAPO0T	Preclinical	Ciglitazone decreases the expression of E3 ubiquitin-protein ligase XIAP.	[68]
SB 203580	DMAET6F	Terminated	SB 203580 decreases the expression of E3 ubiquitin-protein ligase XIAP.	[41]
WIN-55212-2	DMACBIW	Terminated	WIN-55212-2 decreases the expression of E3 ubiquitin-protein ligase XIAP.	[70]
F-12509A	DM3786U	Terminated	F-12509A decreases the expression of E3 ubiquitin-protein ligase XIAP.	[71]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of E3 ubiquitin-protein ligase XIAP.	[72]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of E3 ubiquitin-protein ligase XIAP.	[73]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of E3 ubiquitin-protein ligase XIAP.	[74]
Deguelin	DMXT7WG	Investigative	Deguelin decreases the expression of E3 ubiquitin-protein ligase XIAP.	[75]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate increases the expression of E3 ubiquitin-protein ligase XIAP.	[76]
Paraquat	DMR8O3X	Investigative	Paraquat decreases the expression of E3 ubiquitin-protein ligase XIAP.	[77]
Glyphosate	DM0AFY7	Investigative	Glyphosate increases the expression of E3 ubiquitin-protein ligase XIAP.	[78]
cinnamaldehyde	DMZDUXG	Investigative	cinnamaldehyde decreases the expression of E3 ubiquitin-protein ligase XIAP.	[79]
Cordycepin	DM72Y01	Investigative	Cordycepin decreases the expression of E3 ubiquitin-protein ligase XIAP.	[80]
BRN-3548355	DM4KXT0	Investigative	BRN-3548355 increases the expression of E3 ubiquitin-protein ligase XIAP.	[81]
Chrysin	DM7V2LG	Investigative	Chrysin decreases the expression of E3 ubiquitin-protein ligase XIAP.	[82]
15-deoxy-Delta(12, 14)-prostaglandin J(2)	DM8VUX3	Investigative	15-deoxy-Delta(12, 14)-prostaglandin J(2) decreases the expression of E3 ubiquitin-protein ligase XIAP.	[83]
gingerol	DMNXYSM	Investigative	gingerol decreases the expression of E3 ubiquitin-protein ligase XIAP.	[84]
MANGIFERIN	DMWAF5Z	Investigative	MANGIFERIN decreases the expression of E3 ubiquitin-protein ligase XIAP.	[85]
Beta-D-Glucose	DM5IHYP	Investigative	Beta-D-Glucose decreases the expression of E3 ubiquitin-protein ligase XIAP.	[86]
BAY11-7082	DMQNOFA	Investigative	BAY11-7082 decreases the expression of E3 ubiquitin-protein ligase XIAP.	[11]
Hyperforin	DM2L3PE	Investigative	Hyperforin decreases the expression of E3 ubiquitin-protein ligase XIAP.	[87]
DEMETHOXYCURCUMIN	DMO5UGV	Investigative	DEMETHOXYCURCUMIN decreases the expression of E3 ubiquitin-protein ligase XIAP.	[88]
Caffeic acid phenethyl ester	DMRJKIV	Investigative	Caffeic acid phenethyl ester decreases the expression of E3 ubiquitin-protein ligase XIAP.	[89]
Ellipticine	DMHPYSM	Investigative	Ellipticine decreases the expression of E3 ubiquitin-protein ligase XIAP.	[90]
H-89	DM4RVGO	Investigative	H-89 decreases the expression of E3 ubiquitin-protein ligase XIAP.	[91]
SC-560	DMT1GJL	Investigative	SC-560 decreases the expression of E3 ubiquitin-protein ligase XIAP.	[92]
PHA-665752	DMCGX9U	Investigative	PHA-665752 decreases the expression of E3 ubiquitin-protein ligase XIAP.	[93]
GW-8510	DML4UMT	Investigative	GW-8510 decreases the expression of E3 ubiquitin-protein ligase XIAP.	[94]
------------------------------------------------------------------------------------


⏷ Show the Full List of 93 Drug(s)

4 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Phenoxodiol	DMBUJVX	Phase 1/2	Phenoxodiol increases the degradation of E3 ubiquitin-protein ligase XIAP.	[57]
LY293111	DM03FHA	Discontinued in Phase 2	LY293111 increases the cleavage of E3 ubiquitin-protein ligase XIAP.	[65]
MG-132	DMKA2YS	Preclinical	MG-132 increases the cleavage of E3 ubiquitin-protein ligase XIAP.	[67]
EMBELIN	DMFZO4Y	Terminated	EMBELIN increases the degradation of E3 ubiquitin-protein ligase XIAP.	[69]
------------------------------------------------------------------------------------

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of E3 ubiquitin-protein ligase XIAP.	[58]
PD98059	DMZC90M	Investigative	PD98059 decreases the phosphorylation of E3 ubiquitin-protein ligase XIAP.	[41]
------------------------------------------------------------------------------------

References

1	XIAP deficiency in humans causes an X-linked lymphoproliferative syndrome. Nature. 2006 Nov 2;444(7115):110-4. doi: 10.1038/nature05257.
2	Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
3	Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
4	Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
5	Resistance to diverse apoptotic triggers in multidrug resistant HL60 cells and its possible relationship to the expression of P-glycoprotein, Fas and of the novel anti-apoptosis factors IAP (inhibitory of apoptosis proteins). Cancer Lett. 2002 Jun 6;180(1):91-101. doi: 10.1016/s0304-3835(01)00834-5.
6	Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
7	Down-regulation of FAK and IAPs by laminin during cisplatin-induced apoptosis in testicular germ cell tumors. Int J Oncol. 2006 Feb;28(2):535-42.
8	Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
9	Multifaceted preventive effects of single agent quercetin on a human prostate adenocarcinoma cell line (PC-3): implications for nutritional transcriptomics and multi-target therapy. Med Oncol. 2011 Dec;28(4):1395-404. doi: 10.1007/s12032-010-9603-3. Epub 2010 Jul 2.
10	Inhibition of nuclear factor-kappaB activity by temozolomide involves O6-methylguanine induced inhibition of p65 DNA binding. Cancer Res. 2007 Jul 15;67(14):6889-98.
11	Arsenic trioxide induces apoptosis of human monocytes during macrophagic differentiation through nuclear factor-kappaB-related survival pathway down-regulation. J Pharmacol Exp Ther. 2006 Jan;316(1):304-14. doi: 10.1124/jpet.105.092874. Epub 2005 Sep 20.
12	NF-B potentiates caspase independent hydrogen peroxide induced cell death. PLoS One. 2011 Feb 15;6(2):e16815. doi: 10.1371/journal.pone.0016815.
13	Apoptosis induction by 1alpha,25-dihydroxyvitamin D3 in prostate cancer. Mol Cancer Ther. 2002 Jul;1(9):667-77.
14	Activity of suberoylanilide hydroxamic Acid against human breast cancer cells with amplification of her-2. Clin Cancer Res. 2005 Sep 1;11(17):6382-9. doi: 10.1158/1078-0432.CCR-05-0344.
15	Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
16	5-Aza-2'-deoxycytidine sensitizes busulfan-resistant myeloid leukemia cells by regulating expression of genes involved in cell cycle checkpoint and apoptosis. Leuk Res. 2010 Mar;34(3):364-72. doi: 10.1016/j.leukres.2009.08.014. Epub 2009 Sep 3.
17	Effect of zoledronic acid on oral fibroblasts and epithelial cells: a potential mechanism of bisphosphonate-associated osteonecrosis. Br J Haematol. 2009 Mar;144(5):667-76. doi: 10.1111/j.1365-2141.2008.07504.x. Epub 2008 Nov 20.
18	Novel proapoptotic agent SM-1 enhances the inhibitory effect of 5-fluorouracil on colorectal cancer cells in vitro and in vivo. Oncol Lett. 2017 Jun;13(6):4762-4768. doi: 10.3892/ol.2017.6043. Epub 2017 Apr 19.
19	Glucocorticoids inhibit cell death in ovarian cancer and up-regulate caspase inhibitor cIAP2. Clin Cancer Res. 2005 Sep 1;11(17):6325-32. doi: 10.1158/1078-0432.CCR-05-0182.
20	Antineoplastic mechanisms of niclosamide in acute myelogenous leukemia stem cells: inactivation of the NF-kappaB pathway and generation of reactive oxygen species. Cancer Res. 2010 Mar 15;70(6):2516-27. doi: 10.1158/0008-5472.CAN-09-3950. Epub 2010 Mar 9.
21	Cannabidiol promotes apoptosis via regulation of XIAP/Smac in gastric cancer. Cell Death Dis. 2019 Nov 7;10(11):846. doi: 10.1038/s41419-019-2001-7.
22	The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
23	All-trans retinoic acid can intensify the growth inhibition and differentiation induction effect of rosiglitazone on multiple myeloma cells. Eur J Haematol. 2009 Sep;83(3):191-202. doi: 10.1111/j.1600-0609.2009.01277.x. Epub 2009 May 8.
24	Aspirin induces apoptosis through the blockade of IL-6-STAT3 signaling pathway in human glioblastoma A172 cells. Biochem Biophys Res Commun. 2009 Sep 18;387(2):342-7. doi: 10.1016/j.bbrc.2009.07.022. Epub 2009 Jul 10.
25	2-Methoxyestradiol and paclitaxel have similar effects on the cell cycle and induction of apoptosis in prostate cancer cells. Cancer Lett. 2006 Jan 8;231(1):49-64. doi: 10.1016/j.canlet.2005.01.018.
26	Nicotine inhibits cisplatin-induced apoptosis in NCI-H446 cells. Med Oncol. 2012 Mar;29(1):364-73. doi: 10.1007/s12032-010-9792-9. Epub 2011 Jan 26.
27	Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
28	Molecular basis of rifampicin-induced inhibition of anti-CD95-induced apoptosis of peripheral blood T lymphocytes: the role of CD95 ligand and FLIPs. J Clin Immunol. 2003 Jan;23(1):11-22. doi: 10.1023/a:1021944113833.
29	Upon drug-induced apoptosis in lymphoma cells X-linked inhibitor of apoptosis (XIAP) translocates from the cytosol to the nucleus. Leuk Lymphoma. 2004 Jul;45(7):1429-36. doi: 10.1080/1042819042000198858.
30	Antimyeloma activity of two novel N-substituted and tetraflourinated thalidomide analogs. Leukemia. 2005 Jul;19(7):1253-61. doi: 10.1038/sj.leu.2403776.
31	Sorafenib induces apoptosis of AML cells via Bim-mediated activation of the intrinsic apoptotic pathway. Leukemia. 2008 Apr;22(4):808-18. doi: 10.1038/sj.leu.2405098. Epub 2008 Jan 17.
32	LC, a novel estrone-rhein hybrid compound, promotes proliferation and differentiation and protects against cell death in human osteoblastic MG-63 cells. Mol Cell Endocrinol. 2011 Sep 15;344(1-2):59-68. doi: 10.1016/j.mce.2011.06.027. Epub 2011 Jul 13.
33	Synergy is achieved by complementation with Apo2L/TRAIL and actinomycin D in Apo2L/TRAIL-mediated apoptosis of prostate cancer cells: role of XIAP in resistance. Prostate. 2002 Dec 1;53(4):286-99. doi: 10.1002/pros.10155.
34	Cyclooxygenase-2 inhibitor celecoxib augments chemotherapeutic drug-induced apoptosis by enhancing activation of caspase-3 and -9 in prostate cancer cells. Int J Cancer. 2005 Jun 20;115(3):484-92. doi: 10.1002/ijc.20878.
35	Apoptotic signaling pathways induced by nitric oxide in human lymphoblastoid cells expressing wild-type or mutant p53. Cancer Res. 2004 May 1;64(9):3022-9. doi: 10.1158/0008-5472.can-03-1880.
36	Levonorgestrel enhances spermatogenesis suppression by testosterone with greater alteration in testicular gene expression in men. Biol Reprod. 2009 Mar;80(3):484-92.
37	Antitumor action of the MET tyrosine kinase inhibitor crizotinib (PF-02341066) in gastric cancer positive for MET amplification. Mol Cancer Ther. 2012 Jul;11(7):1557-64. doi: 10.1158/1535-7163.MCT-11-0934. Epub 2012 Jun 22.
38	Anticancer effects of cantharidin in A431 human skin cancer (Epidermoid carcinoma) cells in vitro and in vivo. Environ Toxicol. 2017 Mar;32(3):723-738. doi: 10.1002/tox.22273. Epub 2016 Apr 25.
39	The hepatotoxic fluoroquinolone trovafloxacin disturbs TNF- and LPS-induced p65 nuclear translocation in vivo and in vitro. Toxicol Appl Pharmacol. 2020 Mar 15;391:114915. doi: 10.1016/j.taap.2020.114915. Epub 2020 Feb 6.
40	Synergistic effects of chemotherapeutic drugs in lymphoma cells are associated with down-regulation of inhibitor of apoptosis proteins (IAPs), prostate-apoptosis-response-gene 4 (Par-4), death-associated protein (Daxx) and with enforced caspase activation. Biochem Pharmacol. 2003 Sep 1;66(5):711-24. doi: 10.1016/s0006-2952(03)00410-6.
41	Regorefenib induces extrinsic/intrinsic apoptosis and inhibits MAPK/NF-B-modulated tumor progression in bladder cancer in vitro and in vivo. Environ Toxicol. 2019 Jun;34(6):679-688. doi: 10.1002/tox.22734. Epub 2019 Feb 25.
42	Resveratrol modulates mRNA transcripts of genes related to redox metabolism and cell proliferation in non-small-cell lung carcinoma cells. Biol Chem. 2007 Feb;388(2):207-19.
43	Epigallocatechin-3-gallate induces mitochondrial membrane depolarization and caspase-dependent apoptosis in pancreatic cancer cells. Carcinogenesis. 2005 May;26(5):958-67. doi: 10.1093/carcin/bgi040. Epub 2005 Feb 10.
44	The antitumor activities of curcumin and of its isoxazole analogue are not affected by multiple gene expression changes in an MDR model of the MCF-7 breast cancer cell line: analysis of the possible molecular basis. Int J Mol Med. 2007 Sep;20(3):329-35.
45	Anti-proliferative activity of fenretinide in human hepatoma cells in vitro and in vivo. Anticancer Drugs. 2007 Jan;18(1):47-53. doi: 10.1097/CAD.0b013e32800feeb5.
46	Andrographolide causes apoptosis via inactivation of STAT3 and Akt and potentiates antitumor activity of gemcitabine in pancreatic cancer. Toxicol Lett. 2013 Sep 12;222(1):23-35. doi: 10.1016/j.toxlet.2013.06.241. Epub 2013 Jul 8.
47	Molecular targets and anticancer potential of indole-3-carbinol and its derivatives. Cell Cycle. 2005 Sep;4(9):1201-15. doi: 10.4161/cc.4.9.1993. Epub 2005 Sep 6.
48	Inhibition of PI3K signaling pathway enhances the chemosensitivity of APL cells to ATO: Proposing novel therapeutic potential for BKM120. Eur J Pharmacol. 2018 Dec 15;841:10-18. doi: 10.1016/j.ejphar.2018.10.007. Epub 2018 Oct 11.
49	Rebamipide suppresses 5-fluorouracil-induced cell death via the activation of Akt/mTOR pathway and regulates the expression of Bcl-2 family proteins. Toxicol In Vitro. 2018 Feb;46:284-293. doi: 10.1016/j.tiv.2017.10.019. Epub 2017 Oct 17.
50	NIK-333 inhibits growth of human T-cell leukemia virus type I-infected T-cell lines and adult T-cell leukemia cells in association with blockade of nuclear factor-kappaB signal pathway. Mol Cancer Ther. 2006 Mar;5(3):704-12. doi: 10.1158/1535-7163.MCT-05-0434.
51	Genistein selectively potentiates arsenic trioxide-induced apoptosis in human leukemia cells via reactive oxygen species generation and activation of reactive oxygen species-inducible protein kinases (p38-MAPK, AMPK). Int J Cancer. 2008 Sep 1;123(5):1205-14. doi: 10.1002/ijc.23639.
52	Effects of antioxidants and caspase-3 inhibitor on the phenylethyl isothiocyanate-induced apoptotic signaling pathways in human PLC/PRF/5 cells. Eur J Pharmacol. 2005 Aug 22;518(2-3):96-106. doi: 10.1016/j.ejphar.2005.06.021.
53	Flavopiridol down-regulates antiapoptotic proteins and sensitizes human breast cancer cells to epothilone B-induced apoptosis. Cancer Res. 2003 Jan 1;63(1):93-9.
54	Accumulation of p53 and reductions in XIAP abundance promote the apoptosis of prostate cancer cells. Cancer Res. 2005 Sep 1;65(17):7717-23. doi: 10.1158/0008-5472.CAN-05-0347.
55	Protein kinase inhibitors flavopiridol and 7-hydroxy-staurosporine down-regulate antiapoptosis proteins in B-cell chronic lymphocytic leukemia. Blood. 2000 Jul 15;96(2):393-7.
56	STX140 and STX641 cause apoptosis via the intrinsic mitochondrial pathway and down-regulate survivin and XIAP expression in ovarian and prostate cancer cells. Anticancer Res. 2009 Oct;29(10):3751-7.
57	Molecular mechanism of phenoxodiol-induced apoptosis in ovarian carcinoma cells. Cancer. 2006 Feb 1;106(3):599-608. doi: 10.1002/cncr.21633.
58	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
59	Synergistic activity of BET protein antagonist-based combinations in mantle cell lymphoma cells sensitive or resistant to ibrutinib. Blood. 2015 Sep 24;126(13):1565-74.
60	Akt and XIAP regulate the sensitivity of human uterine cancer cells to cisplatin, doxorubicin and taxol. Apoptosis. 2008 Feb;13(2):259-71. doi: 10.1007/s10495-007-0165-6.
61	VS-5584 as a PI3K/mTOR inhibitor enhances apoptotic effects of subtoxic dose arsenic trioxide via inhibition of NF-B activity in B cell precursor-acute lymphoblastic leukemia. Biomed Pharmacother. 2018 Jun;102:428-437. doi: 10.1016/j.biopha.2018.03.009. Epub 2018 Mar 23.
62	Cell type variation in responses to antimitotic drugs that target microtubules and kinesin-5. Cancer Res. 2008 May 1;68(9):3269-76. doi: 10.1158/0008-5472.CAN-07-6699.
63	Oxidative stress modulates theophylline effects on steroid responsiveness. Biochem Biophys Res Commun. 2008 Dec 19;377(3):797-802.
64	Rottlerin induces autophagy which leads to apoptotic cell death through inhibition of PI3K/Akt/mTOR pathway in human pancreatic cancer stem cells. Biochem Pharmacol. 2012 Nov 1;84(9):1154-63. doi: 10.1016/j.bcp.2012.08.007. Epub 2012 Aug 15.
65	Leukotriene B4 receptor inhibitor LY293111 induces cell cycle arrest and apoptosis in human anaplastic large-cell lymphoma cells via JNK phosphorylation. Leukemia. 2005 Nov;19(11):1977-84. doi: 10.1038/sj.leu.2403929.
66	Critical role of endogenous Akt/IAPs and MEK1/ERK pathways in counteracting endoplasmic reticulum stress-induced cell death. J Biol Chem. 2004 Nov 19;279(47):49420-9. doi: 10.1074/jbc.M407700200. Epub 2004 Aug 31.
67	Proteasome inhibitor MG132 sensitizes HPV-positive human cervical cancer cells to rhTRAIL-induced apoptosis. Int J Cancer. 2006 Apr 15;118(8):1892-900. doi: 10.1002/ijc.21580.
68	Ciglitazone induces caspase-independent apoptosis through down-regulation of XIAP and survivin in human glioma cells. Neurochem Res. 2008 Mar;33(3):551-61. doi: 10.1007/s11064-007-9475-x. Epub 2007 Oct 17.
69	XIAP inhibitor embelin induces autophagic and apoptotic cell death in human oral squamous cell carcinoma cells. Environ Toxicol. 2017 Nov;32(11):2371-2378. doi: 10.1002/tox.22450. Epub 2017 Jul 19.
70	WIN55,212-2 induces caspase-independent apoptosis on human glioblastoma cells by regulating HSP70, p53 and Cathepsin D. Toxicol In Vitro. 2019 Jun;57:233-243. doi: 10.1016/j.tiv.2019.02.009. Epub 2019 Feb 15.
71	Overcoming MDR-associated chemoresistance in HL-60 acute myeloid leukemia cells by targeting sphingosine kinase-1. Leukemia. 2006 Jan;20(1):95-102. doi: 10.1038/sj.leu.2404023.
72	Genome-wide expression changes induced by bisphenol A, F and S in human stem cell derived hepatocyte-like cells. EXCLI J. 2020 Nov 4;19:1459-1476. doi: 10.17179/excli2020-2934. eCollection 2020.
73	From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
74	Sulforaphane-induced apoptosis in human leukemia HL-60 cells through extrinsic and intrinsic signal pathways and altering associated genes expression assayed by cDNA microarray. Environ Toxicol. 2017 Jan;32(1):311-328.
75	Down-regulation of inhibitor of apoptosis proteins by deguelin selectively induces apoptosis in breast cancer cells. Mol Pharmacol. 2007 Jan;71(1):101-11. doi: 10.1124/mol.106.027367. Epub 2006 Oct 11.
76	Differential effect of methyl-, butyl- and propylparaben and 17-estradiol on selected cell cycle and apoptosis gene and protein expression in MCF-7 breast cancer cells and MCF-10A non-malignant cells. J Appl Toxicol. 2014 Sep;34(9):1041-50. doi: 10.1002/jat.2978. Epub 2014 Jan 30.
77	Identification of genes associated with paraquat-induced toxicity in SH-SY5Y cells by PCR array focused on apoptotic pathways. J Toxicol Environ Health A. 2008;71(22):1457-67. doi: 10.1080/15287390802329364.
78	Use of human neuroblastoma SH-SY5Y cells to evaluate glyphosate-induced effects on oxidative stress, neuronal development and cell death signaling pathways. Environ Int. 2020 Feb;135:105414. doi: 10.1016/j.envint.2019.105414. Epub 2019 Dec 23.
79	Effects of vitamin E on the cinnamaldehyde-induced apoptotic mechanism in human PLC/PRF/5 cells. Clin Exp Pharmacol Physiol. 2004 Nov;31(11):770-6. doi: 10.1111/j.1440-1681.2004.04091.x.
80	Induction of apoptosis by cordycepin via reactive oxygen species generation in human leukemia cells. Toxicol In Vitro. 2011 Jun;25(4):817-24. doi: 10.1016/j.tiv.2011.02.001. Epub 2011 Feb 15.
81	Long-term exposure to extremely low-dose of nicotine and 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone (NNK) induce non-malignant breast epithelial cell transformation through activation of the a9-nicotinic acetylcholine receptor-mediated signaling pathway. Environ Toxicol. 2019 Jan;34(1):73-82. doi: 10.1002/tox.22659. Epub 2018 Sep 26.
82	Bcl-2 attenuates anticancer agents-induced apoptosis by sustained activation of Akt/protein kinase B in U937 cells. Apoptosis. 2005 Dec;10(6):1333-43. doi: 10.1007/s10495-005-2763-5.
83	15-Deoxy-delta 12,14-prostaglandin J2 induces apoptosis in human malignant B cells: an effect associated with inhibition of NF-kappa B activity and down-regulation of antiapoptotic proteins. Blood. 2005 Feb 15;105(4):1750-8. doi: 10.1182/blood-2004-04-1360. Epub 2004 Oct 21.
84	Gingerol sensitizes TRAIL-induced apoptotic cell death of glioblastoma cells. Toxicol Appl Pharmacol. 2014 Sep 15;279(3):253-265. doi: 10.1016/j.taap.2014.06.030. Epub 2014 Jul 14.
85	Mangiferin induces apoptosis by suppressing Bcl-xL and XIAP expressions and nuclear entry of NF-B in HL-60 cells. Arch Pharm Res. 2011 Mar;34(3):469-75. doi: 10.1007/s12272-011-0316-8. Epub 2011 May 6.
86	Neisseria gonorrhoeae delays the onset of apoptosis in polymorphonuclear leukocytes. Cell Microbiol. 2006 Nov;8(11):1780-90. doi: 10.1111/j.1462-5822.2006.00748.x. Epub 2006 Jun 27.
87	Hyperforin induces apoptosis through extrinsic/intrinsic pathways and inhibits EGFR/ERK/NF-B-mediated anti-apoptotic potential in glioblastoma. Environ Toxicol. 2020 Oct;35(10):1058-1069. doi: 10.1002/tox.22942. Epub 2020 Jun 2.
88	Demethoxycurcumin induces apoptosis in HER2 overexpressing bladder cancer cells through degradation of HER2 and inhibiting the PI3K/Akt pathway. Environ Toxicol. 2021 Nov;36(11):2186-2195. doi: 10.1002/tox.23332. Epub 2021 Jul 22.
89	Caffeic acid phenethyl ester-induced PC-3 cell apoptosis is caspase-dependent and mediated through the loss of inhibitors of apoptosis proteins. BJU Int. 2004 Aug;94(3):402-6. doi: 10.1111/j.1464-410X.2004.04936.x.
90	The anti-proliferative inhibition of ellipticine in human breast mda-mb-231 cancer cells is through cell cycle arrest and apoptosis induction. Anticancer Drugs. 2005 Aug;16(7):789-95. doi: 10.1097/01.cad.0000171768.36317.93.
91	Heterotrimeric stimulatory GTP-binding proteins inhibit cisplatin-induced apoptosis by increasing X-linked inhibitor of apoptosis protein expression in cervical cancer cells. Cancer Sci. 2011 Apr;102(4):837-44. doi: 10.1111/j.1349-7006.2011.01883.x. Epub 2011 Feb 28.
92	The selective cyclooxygenase-1 inhibitor SC-560 suppresses cell proliferation and induces apoptosis in human hepatocellular carcinoma cells. Int J Mol Med. 2006 Feb;17(2):245-52.
93	HGF/c-Met pathway has a prominent role in mediating antiapoptotic signals through AKT in epithelial ovarian carcinoma. Lab Invest. 2011 Jan;91(1):124-37. doi: 10.1038/labinvest.2010.136. Epub 2010 Jul 26.
94	Downregulation of XIAP and induction of apoptosis by the synthetic cyclin-dependent kinase inhibitor GW8510 in non-small cell lung cancer cells. Cancer Biol Ther. 2006 Feb;5(2):165-70. doi: 10.4161/cbt.5.2.2316. Epub 2006 Feb 10.
95	Expression and prognostic significance of IAP-family genes in human cancers and myeloid leukemias. Clin Cancer Res. 2000 May;6(5):1796-803.
96	Expression of X-linked inhibitor of apoptosis protein and its effect on chemotherapeutic sensitivity of bladder carcinoma. J Huazhong Univ Sci Technolog Med Sci. 2007 Jun;27(3):285-7. doi: 10.1007/s11596-007-0317-5.
97	XIAP is related to the chemoresistance and inhibited its expression by RNA interference sensitize pancreatic carcinoma cells to chemotherapeutics. Pancreas. 2006 Apr;32(3):288-96. doi: 10.1097/01.mpa.0000218314.67111.fb.
98	Targeting of X-linked inhibitor of apoptosis protein or survivin by short interfering RNAs sensitize hepatoma cells to TNF-related apoptosis-inducing ligand- and chemotherapeutic agent-induced cell death. Oncol Rep. 2005 Nov;14(5):1311-6.
99	Regulation of p53 and suppression of apoptosis by the soluble guanylyl cyclase/cGMP pathway in human ovarian cancer cells. Oncogene. 2006 Apr 6;25(15):2203-12. doi: 10.1038/sj.onc.1209251.