Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT2B7HR9)

• DOT Name: C-C motif chemokine 26 (CCL26)
• Synonyms: CC chemokine IMAC; Eotaxin-3; Macrophage inflammatory protein 4-alpha; MIP-4-alpha; Small-inducible cytokine A26; Thymic stroma chemokine-1; TSC-1
• Gene Name: CCL26
• Related Disease:
  Parkinson disease
  Primary biliary cholangitis
  Allergic rhinitis
  Alzheimer disease
  Alzheimer disease 3
  Asthma
  Autoimmune disease
  Bullous pemphigoid
  Coffin-Siris syndrome
  Craniosynostosis
  Dermatitis
  Eosinophilic esophagitis
  Eosinophilic granulomatosis with polyangiitis
  Esophageal squamous cell carcinoma
  Esophagitis
  Hepatocellular carcinoma
  Inflammatory bowel disease
  Mastocytosis
  Multiple sclerosis
  Nasal polyp
  Nervous system inflammation
  Pneumonia
  Pneumonitis
  Relapsing-remitting multiple sclerosis
  Respiratory disease
  Rhegmatogenous retinal detachment
  Secondary progressive multiple sclerosis
  Ulcerative colitis
  Vasculitis
  Atopic dermatitis
  Gastroesophageal reflux disease
  Neuromyelitis optica
  Pachyonychia congenita 3
  Primary cutaneous T-cell lymphoma
  Vernal keratoconjunctivitis
• UniProt ID: CCL26_HUMAN
• PDB ID: 1G2S; 1G2T
• Pfam ID: PF00048
• Sequence:
  MMGLSLASAVLLASLLSLHLGTATRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQR
  AVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL
• Function: Chemoattractant for eosinophils and basophils. Acts as a ligand for C-C chemokine receptor CCR3 which triggers Ca(2+) mobilization in eosinophils. Also acts as a ligand for CX3C chemokine receptor CX3CR1, inducing cell chemotaxis.
• Tissue Specificity: Ubiquitously expressed at low levels in various tissues including heart and ovary.
• KEGG Pathway:
  Cytokine-cytokine receptor interaction (hsa04060)
  Viral protein interaction with cytokine and cytokine receptor (hsa04061)
  Chemokine sig.ling pathway (hsa04062)

Molecular Interaction Atlas (MIA) of This DOT

35 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Parkinson disease	DISQVHKL	Definitive	Altered Expression	[1]
Primary biliary cholangitis	DIS43E0O	Definitive	Altered Expression	[2]
Allergic rhinitis	DIS3U9HN	Strong	Biomarker	[3]
Alzheimer disease	DISF8S70	Strong	Biomarker	[4]
Alzheimer disease 3	DISVT69G	Strong	Biomarker	[4]
Asthma	DISW9QNS	Strong	Altered Expression	[5]
Autoimmune disease	DISORMTM	Strong	Genetic Variation	[6]
Bullous pemphigoid	DISOJLKV	Strong	Altered Expression	[7]
Coffin-Siris syndrome	DIS8L03H	Strong	Genetic Variation	[8]
Craniosynostosis	DIS6J405	Strong	Altered Expression	[9]
Dermatitis	DISY5SZC	Strong	Altered Expression	[10]
Eosinophilic esophagitis	DISR8WSB	Strong	Biomarker	[11]
Eosinophilic granulomatosis with polyangiitis	DIS7ITOG	Strong	Biomarker	[8]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Biomarker	[12]
Esophagitis	DISHVC9B	Strong	Altered Expression	[13]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[14]
Inflammatory bowel disease	DISGN23E	Strong	Altered Expression	[15]
Mastocytosis	DIS1TEE0	Strong	Altered Expression	[16]
Multiple sclerosis	DISB2WZI	Strong	Biomarker	[17]
Nasal polyp	DISLP3XE	Strong	Altered Expression	[18]
Nervous system inflammation	DISB3X5A	Strong	Biomarker	[17]
Pneumonia	DIS8EF3M	Strong	Altered Expression	[19]
Pneumonitis	DIS88E0K	Strong	Altered Expression	[19]
Relapsing-remitting multiple sclerosis	DISSXFCF	Strong	Altered Expression	[17]
Respiratory disease	DISGGAGJ	Strong	Altered Expression	[20]
Rhegmatogenous retinal detachment	DISLE27J	Strong	Biomarker	[21]
Secondary progressive multiple sclerosis	DISAJTO1	Strong	Biomarker	[17]
Ulcerative colitis	DIS8K27O	Strong	Biomarker	[15]
Vasculitis	DISQRKDX	Strong	Altered Expression	[8]
Atopic dermatitis	DISTCP41	Limited	Altered Expression	[22]
Gastroesophageal reflux disease	DISQ8G5S	Limited	Altered Expression	[23]
Neuromyelitis optica	DISBFGKL	Limited	Altered Expression	[17]
Pachyonychia congenita 3	DISZLC6C	Limited	Altered Expression	[24]
Primary cutaneous T-cell lymphoma	DIS35WVW	Limited	Altered Expression	[25]
Vernal keratoconjunctivitis	DIS36LV6	Limited	Altered Expression	[26]

16 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of C-C motif chemokine 26 (CCL26).	[27]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of C-C motif chemokine 26 (CCL26).	[28]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of C-C motif chemokine 26 (CCL26).	[29]
Arsenic	DMTL2Y1	Approved	Arsenic affects the expression of C-C motif chemokine 26 (CCL26).	[30]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of C-C motif chemokine 26 (CCL26).	[31]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of C-C motif chemokine 26 (CCL26).	[33]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of C-C motif chemokine 26 (CCL26).	[34]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol affects the expression of C-C motif chemokine 26 (CCL26).	[35]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of C-C motif chemokine 26 (CCL26).	[34]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of C-C motif chemokine 26 (CCL26).	[36]
Belinostat	DM6OC53	Phase 2	Belinostat increases the expression of C-C motif chemokine 26 (CCL26).	[34]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of C-C motif chemokine 26 (CCL26).	[38]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of C-C motif chemokine 26 (CCL26).	[39]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of C-C motif chemokine 26 (CCL26).	[40]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of C-C motif chemokine 26 (CCL26).	[41]
crotylaldehyde	DMTWRQI	Investigative	crotylaldehyde increases the expression of C-C motif chemokine 26 (CCL26).	[42]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the secretion of C-C motif chemokine 26 (CCL26).	[32]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of C-C motif chemokine 26 (CCL26).	[37]

References

• [1] Eotaxins and C-C chemokine receptor type 3 in Parkinson's disease.Acta Neurol Belg. 2020 Jun;120(3):589-594. doi: 10.1007/s13760-018-01061-8. Epub 2018 Dec 13.
• [2] Association of CCL11, CCL24 and CCL26 with primary biliary cholangitis.Int Immunopharmacol. 2019 Feb;67:372-377. doi: 10.1016/j.intimp.2018.12.026. Epub 2018 Dec 22.
• [3] Interleukin-17A potentiates interleukin-13-induced eotaxin-3 production by human nasal epithelial cells from patients with allergic rhinitis.Int Forum Allergy Rhinol. 2019 Nov;9(11):1327-1333. doi: 10.1002/alr.22382. Epub 2019 Aug 12.
• [4] Analysis of eotaxin 1/CCL11, eotaxin 2/CCL24 and eotaxin 3/CCL26 expression in lesional and non-lesional skin of patients with atopic dermatitis.Cytokine. 2010 May;50(2):181-5. doi: 10.1016/j.cyto.2010.02.016. Epub 2010 Mar 16.
• [5] Epithelial SERPINB10, a novel marker of airway eosinophilia in asthma, contributes to allergic airway inflammation.Am J Physiol Lung Cell Mol Physiol. 2019 Jan 1;316(1):L245-L254. doi: 10.1152/ajplung.00362.2017. Epub 2018 Nov 1.
• [6] Eotaxin-3 gene polymorphisms are associated with rheumatoid arthritis in a Korean population.Hum Immunol. 2005 Mar;66(3):314-20. doi: 10.1016/j.humimm.2005.01.002.
• [7] Increased Activity and Apoptosis of Eosinophils in Blister Fluids, Skin and Peripheral Blood of Patients with Bullous Pemphigoid.Acta Derm Venereol. 2017 Apr 6;97(4):464-471. doi: 10.2340/00015555-2581.
• [8] Eotaxin-3 in Churg-Strauss syndrome: a clinical and immunogenetic study.Rheumatology (Oxford). 2011 Oct;50(10):1823-7. doi: 10.1093/rheumatology/keq445. Epub 2011 Jan 25.
• [9] Proton pump inhibitors decrease eotaxin-3/CCL26 expression in patients with chronic rhinosinusitis with nasal polyps: Possible role of the nongastric H,K-ATPase.J Allergy Clin Immunol. 2017 Jan;139(1):130-141.e11. doi: 10.1016/j.jaci.2016.07.020. Epub 2016 Oct 4.
• [10] The chemokine receptor CCR3 participates in tissue remodeling during atopic skin inflammation.J Dermatol Sci. 2013 Jul;71(1):12-21. doi: 10.1016/j.jdermsci.2013.04.011. Epub 2013 Apr 19.
• [11] One-Hour Esophageal String Test: A Nonendoscopic Minimally Invasive Test That Accurately Detects Disease Activity in Eosinophilic Esophagitis.Am J Gastroenterol. 2019 Oct;114(10):1614-1625. doi: 10.14309/ajg.0000000000000371.
• [12] Genome-wide gene expression profile analyses identify CTTN as a potential prognostic marker in esophageal cancer.PLoS One. 2014 Feb 14;9(2):e88918. doi: 10.1371/journal.pone.0088918. eCollection 2014.
• [13] Increased expression of eotaxin-3 distinguishes between eosinophilic esophagitis and gastroesophageal reflux disease.Hum Pathol. 2007 Dec;38(12):1744-53. doi: 10.1016/j.humpath.2007.05.008. Epub 2007 Sep 27.
• [14] Hepatocellular carcinoma cells cause different responses in expressions of cancer-promoting genes in different cancer-associated fibroblasts.Kaohsiung J Med Sci. 2013 Jun;29(6):312-8. doi: 10.1016/j.kjms.2012.08.012. Epub 2012 Oct 13.
• [15] Regulation of eotaxin-3/CC chemokine ligand 26 expression by T helper type 2 cytokines in human colonic myofibroblasts.Clin Exp Immunol. 2013 Aug;173(2):323-31. doi: 10.1111/cei.12117.
• [16] Eotaxin-3 and a uniquely conserved gene-expression profile in eosinophilic esophagitis.J Clin Invest. 2006 Feb;116(2):536-47. doi: 10.1172/JCI26679.
• [17] CCL26 and CCR3 are associated with the acute inflammatory response in the CNS in experimental autoimmune encephalomyelitis.J Neuroimmunol. 2019 Aug 15;333:576967. doi: 10.1016/j.jneuroim.2019.576967. Epub 2019 May 16.
• [18] Interleukin-4-induced posttranscriptional gene regulation of CCL26 by the RNA-binding protein HuR in primary human nasal polyp-derived epithelial cells.Int Forum Allergy Rhinol. 2019 Mar;9(3):311-321. doi: 10.1002/alr.22250. Epub 2018 Nov 24.
• [19] RNA interference of STAT6 rapidly attenuates ongoing interleukin-13-mediated events in lung epithelial cells.Immunology. 2009 Jun;127(2):256-66. doi: 10.1111/j.1365-2567.2008.02951.x. Epub 2008 Oct 29.
• [20] Eotaxin-3 as a Plasma Biomarker for Mucosal Eosinophil Infiltration in Chronic Rhinosinusitis.Front Immunol. 2019 Feb 4;10:74. doi: 10.3389/fimmu.2019.00074. eCollection 2019.
• [21] Cytokine profiles of phakic and pseudophakic eyes with primary retinal detachment.Acta Ophthalmol. 2019 Jun;97(4):e580-e588. doi: 10.1111/aos.13998. Epub 2018 Dec 18.
• [22] IL-4 regulates chemokine CCL26 in keratinocytes through the Jak1, 2/Stat6 signal transduction pathway: Implication for atopic dermatitis.Mol Immunol. 2012 Feb;50(1-2):91-7. doi: 10.1016/j.molimm.2011.12.008. Epub 2012 Jan 5.
• [23] Omeprazole blocks eotaxin-3 expression by oesophageal squamous cells from patients with eosinophilic oesophagitis and GORD.Gut. 2013 Jun;62(6):824-32. doi: 10.1136/gutjnl-2012-302250. Epub 2012 May 12.
• [24] Mesenchymal stem cells up-regulate the invasive potential of prostate cancer cells via the eotaxin-3/CCR3 axis.Pathol Res Pract. 2018 Sep;214(9):1297-1302. doi: 10.1016/j.prp.2018.06.012. Epub 2018 Jun 25.
• [25] Eotaxins and CCR3 interaction regulates the Th2 environment of cutaneous T-cell lymphoma.J Invest Dermatol. 2010 Sep;130(9):2304-11. doi: 10.1038/jid.2010.128. Epub 2010 May 27.
• [26] Evaluation of eotaxin-1, -2, and -3 protein production and messenger RNA expression in patients with vernal keratoconjunctivitis.Jpn J Ophthalmol. 2009 Mar;53(2):92-99. doi: 10.1007/s10384-008-0628-5. Epub 2009 Mar 31.
• [27] Effects of lithium and valproic acid on gene expression and phenotypic markers in an NT2 neurosphere model of neural development. PLoS One. 2013;8(3):e58822.
• [28] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [29] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [30] Fetal-sex dependent genomic responses in the circulating lymphocytes of arsenic-exposed pregnant women in New Hampshire. Reprod Toxicol. 2017 Oct;73:184-195. doi: 10.1016/j.reprotox.2017.07.023. Epub 2017 Aug 6.
• [31] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [32] Chronic senescent human mesenchymal stem cells as possible contributor to the wound healing disorder after exposure to the alkylating agent sulfur mustard. Arch Toxicol. 2021 Feb;95(2):727-747. doi: 10.1007/s00204-020-02946-5. Epub 2021 Jan 25.
• [33] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [34] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [35] Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
• [36] A novel long noncoding RNA AK001796 acts as an oncogene and is involved in cell growth inhibition by resveratrol in lung cancer. Toxicol Appl Pharmacol. 2015 Jun 1;285(2):79-88.
• [37] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [38] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [39] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [40] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [41] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
• [42] Gene expression profile and cytotoxicity of human bronchial epithelial cells exposed to crotonaldehyde. Toxicol Lett. 2010 Aug 16;197(2):113-22.