Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT3WCTZV)

DOT Name	Growth-regulated alpha protein (CXCL1)
Synonyms	C-X-C motif chemokine 1; GRO-alpha(1-73); Melanoma growth stimulatory activity; MGSA; Neutrophil-activating protein 3; NAP-3
Gene Name	CXCL1
UniProt ID	GROA_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	1MGS; 1MSG; 1MSH; 1ROD
Pfam ID	PF00048
Sequence	MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSV NVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
Function	Has chemotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) show a 30-fold higher chemotactic activity.
KEGG Pathway	Cytokine-cytokine receptor interaction (hsa04060 ) Viral protein interaction with cytokine and cytokine receptor (hsa04061 ) Chemokine sig.ling pathway (hsa04062 ) NF-kappa B sig.ling pathway (hsa04064 ) NOD-like receptor sig.ling pathway (hsa04621 ) IL-17 sig.ling pathway (hsa04657 ) TNF sig.ling pathway (hsa04668 ) Alcoholic liver disease (hsa04936 ) Epithelial cell sig.ling in Helicobacter pylori infection (hsa05120 ) Legionellosis (hsa05134 ) Amoebiasis (hsa05146 ) Kaposi sarcoma-associated herpesvirus infection (hsa05167 ) Rheumatoid arthritis (hsa05323 ) Lipid and atherosclerosis (hsa05417 )
Reactome Pathway	G alpha (i) signalling events (R-HSA-418594 ) Interleukin-10 signaling (R-HSA-6783783 ) Neutrophil degranulation (R-HSA-6798695 ) Chemokine receptors bind chemokines (R-HSA-380108 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Temozolomide	DMKECZD	Approved	Growth-regulated alpha protein (CXCL1) affects the response to substance of Temozolomide.	[52]
DTI-015	DMXZRW0	Approved	Growth-regulated alpha protein (CXCL1) affects the response to substance of DTI-015.	[52]
------------------------------------------------------------------------------------

57 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Growth-regulated alpha protein (CXCL1).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Growth-regulated alpha protein (CXCL1).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Growth-regulated alpha protein (CXCL1).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Growth-regulated alpha protein (CXCL1).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Growth-regulated alpha protein (CXCL1).	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Growth-regulated alpha protein (CXCL1).	[6]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Growth-regulated alpha protein (CXCL1).	[7]
Arsenic	DMTL2Y1	Approved	Arsenic increases the expression of Growth-regulated alpha protein (CXCL1).	[8]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Growth-regulated alpha protein (CXCL1).	[9]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Growth-regulated alpha protein (CXCL1).	[10]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Growth-regulated alpha protein (CXCL1).	[11]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Growth-regulated alpha protein (CXCL1).	[12]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Growth-regulated alpha protein (CXCL1).	[13]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Growth-regulated alpha protein (CXCL1).	[14]
Selenium	DM25CGV	Approved	Selenium increases the expression of Growth-regulated alpha protein (CXCL1).	[15]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Growth-regulated alpha protein (CXCL1).	[10]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Growth-regulated alpha protein (CXCL1).	[16]
Isotretinoin	DM4QTBN	Approved	Isotretinoin decreases the expression of Growth-regulated alpha protein (CXCL1).	[3]
Bortezomib	DMNO38U	Approved	Bortezomib increases the expression of Growth-regulated alpha protein (CXCL1).	[17]
Troglitazone	DM3VFPD	Approved	Troglitazone increases the expression of Growth-regulated alpha protein (CXCL1).	[18]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of Growth-regulated alpha protein (CXCL1).	[19]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the expression of Growth-regulated alpha protein (CXCL1).	[20]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of Growth-regulated alpha protein (CXCL1).	[21]
Clozapine	DMFC71L	Approved	Clozapine decreases the expression of Growth-regulated alpha protein (CXCL1).	[22]
Amphotericin B	DMTAJQE	Approved	Amphotericin B increases the expression of Growth-regulated alpha protein (CXCL1).	[23]
Gemcitabine	DMSE3I7	Approved	Gemcitabine increases the expression of Growth-regulated alpha protein (CXCL1).	[24]
Mifepristone	DMGZQEF	Approved	Mifepristone decreases the expression of Growth-regulated alpha protein (CXCL1).	[25]
Alitretinoin	DMME8LH	Approved	Alitretinoin decreases the expression of Growth-regulated alpha protein (CXCL1).	[3]
Prednisolone	DMQ8FR2	Approved	Prednisolone decreases the expression of Growth-regulated alpha protein (CXCL1).	[19]
Ursodeoxycholic acid	DMCUT21	Approved	Ursodeoxycholic acid increases the expression of Growth-regulated alpha protein (CXCL1).	[27]
Diphenylpyraline	DMW4X37	Approved	Diphenylpyraline decreases the expression of Growth-regulated alpha protein (CXCL1).	[28]
Rofecoxib	DM3P5DA	Approved	Rofecoxib affects the expression of Growth-regulated alpha protein (CXCL1).	[29]
Ritonavir	DMU764S	Approved	Ritonavir decreases the expression of Growth-regulated alpha protein (CXCL1).	[30]
Methylprednisolone	DM4BDON	Approved	Methylprednisolone decreases the expression of Growth-regulated alpha protein (CXCL1).	[19]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Growth-regulated alpha protein (CXCL1).	[32]
Curcumin	DMQPH29	Phase 3	Curcumin decreases the expression of Growth-regulated alpha protein (CXCL1).	[33]
HMPL-004	DM29XGY	Phase 3	HMPL-004 increases the expression of Growth-regulated alpha protein (CXCL1).	[34]
Bardoxolone methyl	DMODA2X	Phase 3	Bardoxolone methyl increases the expression of Growth-regulated alpha protein (CXCL1).	[34]
DNCB	DMDTVYC	Phase 2	DNCB increases the expression of Growth-regulated alpha protein (CXCL1).	[35]
PD-0325901	DM27D4J	Phase 2	PD-0325901 decreases the expression of Growth-regulated alpha protein (CXCL1).	[36]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Growth-regulated alpha protein (CXCL1).	[37]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Growth-regulated alpha protein (CXCL1).	[38]
Eugenol	DM7US1H	Patented	Eugenol increases the expression of Growth-regulated alpha protein (CXCL1).	[39]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Growth-regulated alpha protein (CXCL1).	[40]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Growth-regulated alpha protein (CXCL1).	[41]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Growth-regulated alpha protein (CXCL1).	[42]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Growth-regulated alpha protein (CXCL1).	[43]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Growth-regulated alpha protein (CXCL1).	[44]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Growth-regulated alpha protein (CXCL1).	[45]
Paraquat	DMR8O3X	Investigative	Paraquat increases the expression of Growth-regulated alpha protein (CXCL1).	[46]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the expression of Growth-regulated alpha protein (CXCL1).	[47]
Phencyclidine	DMQBEYX	Investigative	Phencyclidine increases the expression of Growth-regulated alpha protein (CXCL1).	[48]
cinnamaldehyde	DMZDUXG	Investigative	cinnamaldehyde increases the expression of Growth-regulated alpha protein (CXCL1).	[49]
crotylaldehyde	DMTWRQI	Investigative	crotylaldehyde decreases the expression of Growth-regulated alpha protein (CXCL1).	[50]
all-trans-4-oxo-retinoic acid	DMM2R1N	Investigative	all-trans-4-oxo-retinoic acid decreases the expression of Growth-regulated alpha protein (CXCL1).	[3]
2-tert-butylbenzene-1,4-diol	DMNXI1E	Investigative	2-tert-butylbenzene-1,4-diol increases the expression of Growth-regulated alpha protein (CXCL1).	[49]
MG149	DM7V58G	Investigative	MG149 increases the expression of Growth-regulated alpha protein (CXCL1).	[51]
------------------------------------------------------------------------------------


⏷ Show the Full List of 57 Drug(s)

4 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetic Acid, Glacial	DM4SJ5Y	Approved	Acetic Acid, Glacial increases the secretion of Growth-regulated alpha protein (CXCL1).	[26]
Sulfasalazine	DMICA9H	Approved	Sulfasalazine affects the secretion of Growth-regulated alpha protein (CXCL1).	[31]
Sulfapyridine	DMIUYFH	Approved	Sulfapyridine decreases the secretion of Growth-regulated alpha protein (CXCL1).	[31]
Asacolitin	DM3WVPJ	Investigative	Asacolitin increases the secretion of Growth-regulated alpha protein (CXCL1).	[31]
------------------------------------------------------------------------------------

References

1	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2	Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
3	Retinoic acid and its 4-oxo metabolites are functionally active in human skin cells in vitro. J Invest Dermatol. 2005 Jul;125(1):143-53.
4	Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
5	Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
6	Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
7	Bisphenol A effects on gene expression in adipocytes from children: association with metabolic disorders. J Mol Endocrinol. 2015 Jun;54(3):289-303.
8	Gene expression of inflammatory molecules in circulating lymphocytes from arsenic-exposed human subjects. Environ Health Perspect. 2003 Aug;111(11):1429-38. doi: 10.1289/ehp.6396.
9	Unique signatures of stress-induced senescent human astrocytes. Exp Neurol. 2020 Dec;334:113466. doi: 10.1016/j.expneurol.2020.113466. Epub 2020 Sep 17.
10	Progesterone and calcitriol attenuate inflammatory cytokines CXCL1 and CXCL2 in ovarian and endometrial cancer cells. J Cell Biochem. 2012 Oct;113(10):3143-52. doi: 10.1002/jcb.24191.
11	The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
12	Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
13	THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
14	Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
15	Changes in gene expression profiles in response to selenium supplementation among individuals with arsenic-induced pre-malignant skin lesions. Toxicol Lett. 2007 Mar 8;169(2):162-76. doi: 10.1016/j.toxlet.2007.01.006. Epub 2007 Jan 19.
16	Cannabidiol enhances cytotoxicity of anti-cancer drugs in human head and neck squamous cell carcinoma. Sci Rep. 2020 Nov 26;10(1):20622. doi: 10.1038/s41598-020-77674-y.
17	Proteasome inhibitor PS-341 induces apoptosis through induction of endoplasmic reticulum stress-reactive oxygen species in head and neck squamous cell carcinoma cells. Mol Cell Biol. 2004 Nov;24(22):9695-704. doi: 10.1128/MCB.24.22.9695-9704.2004.
18	Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
19	Antirheumatic drug response signatures in human chondrocytes: potential molecular targets to stimulate cartilage regeneration. Arthritis Res Ther. 2009;11(1):R15.
20	CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
21	Dasatinib, a small-molecule protein tyrosine kinase inhibitor, inhibits T-cell activation and proliferation. Blood. 2008 Feb 1;111(3):1366-77. doi: 10.1182/blood-2007-04-084814. Epub 2007 Oct 25.
22	Histamine H4 receptor agonists have more activities than H4 agonism in antigen-specific human T-cell responses. Immunology. 2007 Jun;121(2):266-75. doi: 10.1111/j.1365-2567.2007.02574.x. Epub 2007 Mar 7.
23	Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
24	Gene expression profiling of breast cancer cells in response to gemcitabine: NF-kappaB pathway activation as a potential mechanism of resistance. Breast Cancer Res Treat. 2007 Apr;102(2):157-72.
25	Mifepristone induced progesterone withdrawal reveals novel regulatory pathways in human endometrium. Mol Hum Reprod. 2007 Sep;13(9):641-54.
26	Zinc induces chemokine and inflammatory cytokine release from human promonocytes. J Hazard Mater. 2011 Nov 30;196:335-41. doi: 10.1016/j.jhazmat.2011.09.035. Epub 2011 Sep 19.
27	Ursodeoxycholic acid but not tauroursodeoxycholic acid inhibits proliferation and differentiation of human subcutaneous adipocytes. PLoS One. 2013 Dec 3;8(12):e82086. doi: 10.1371/journal.pone.0082086. eCollection 2013.
28	Controlled diesel exhaust and allergen coexposure modulates microRNA and gene expression in humans: Effects on inflammatory lung markers. J Allergy Clin Immunol. 2016 Dec;138(6):1690-1700. doi: 10.1016/j.jaci.2016.02.038. Epub 2016 Apr 24.
29	Rofecoxib modulates multiple gene expression pathways in a clinical model of acute inflammatory pain. Pain. 2007 Mar;128(1-2):136-47.
30	Transcriptional profiling suggests that Nevirapine and Ritonavir cause drug induced liver injury through distinct mechanisms in primary human hepatocytes. Chem Biol Interact. 2016 Aug 5;255:31-44.
31	The effect of sulfasalazine on rheumatoid arthritic synovial tissue chemokine production. Exp Mol Pathol. 2002 Oct;73(2):84-92. doi: 10.1006/exmp.2002.2460.
32	Chronic resveratrol treatment ameliorates cell adhesion and mitigates the inflammatory phenotype in senescent human fibroblasts. J Gerontol A Biol Sci Med Sci. 2013 Apr;68(4):371-81. doi: 10.1093/gerona/gls183. Epub 2012 Aug 29.
33	Curcumin downregulates the inflammatory cytokines CXCL1 and -2 in breast cancer cells via NFkappaB. Carcinogenesis. 2008 Apr;29(4):779-89.
34	Mapping the dynamics of Nrf2 antioxidant and NFB inflammatory responses by soft electrophilic chemicals in human liver cells defines the transition from adaptive to adverse responses. Toxicol In Vitro. 2022 Oct;84:105419. doi: 10.1016/j.tiv.2022.105419. Epub 2022 Jun 17.
35	Upregulation of genes orchestrating keratinocyte differentiation, including the novel marker gene ID2, by contact sensitizers in human bulge-derived keratinocytes. J Biochem Mol Toxicol. 2010 Jan-Feb;24(1):10-20.
36	PRC2 loss amplifies Ras-driven transcription and confers sensitivity to BRD4-based therapies. Nature. 2014 Oct 9;514(7521):247-51.
37	Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
38	Highly active combination of BRD4 antagonist and histone deacetylase inhibitor against human acute myelogenous leukemia cells. Mol Cancer Ther. 2014 May;13(5):1142-54.
39	Prediction of the contact sensitizing potential of chemicals using analysis of gene expression changes in human THP-1 monocytes. Toxicol Lett. 2010 Nov 10;199(1):51-9.
40	Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.
41	From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
42	Identification of gene markers for formaldehyde exposure in humans. Environ Health Perspect. 2007 Oct;115(10):1460-6. doi: 10.1289/ehp.10180.
43	Effects of antioxidants on oxidative stress and inflammatory responses of human bronchial epithelial cells exposed to particulate matter and cigarette smoke extract. Toxicol In Vitro. 2020 Sep;67:104883. doi: 10.1016/j.tiv.2020.104883. Epub 2020 May 6.
44	Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
45	Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
46	CD34+ derived macrophage and dendritic cells display differential responses to paraquat. Toxicol In Vitro. 2021 Sep;75:105198. doi: 10.1016/j.tiv.2021.105198. Epub 2021 Jun 9.
47	The contact allergen nickel triggers a unique inflammatory and proangiogenic gene expression pattern via activation of NF-kappaB and hypoxia-inducible factor-1alpha. J Immunol. 2007 Mar 1;178(5):3198-207.
48	Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.
49	The THP-1 cell toolbox: a new concept integrating the key events of skin sensitization. Arch Toxicol. 2019 Apr;93(4):941-951.
50	Gene expression profile and cytotoxicity of human bronchial epithelial cells exposed to crotonaldehyde. Toxicol Lett. 2010 Aug 16;197(2):113-22.
51	KAT5 (Tip60) is a potential therapeutic target in malignant pleural mesothelioma. Int J Oncol. 2016 Mar;48(3):1290-6. doi: 10.3892/ijo.2016.3335. Epub 2016 Jan 13.
52	Tumor necrosis factor-alpha-induced protein 3 as a putative regulator of nuclear factor-kappaB-mediated resistance to O6-alkylating agents in human glioblastomas. J Clin Oncol. 2006 Jan 10;24(2):274-87. doi: 10.1200/JCO.2005.02.9405. Epub 2005 Dec 19.