Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT564IX4)

• DOT Name: Cohesin subunit SA-1 (STAG1)
• Synonyms: SCC3 homolog 1; Stromal antigen 1
• Gene Name: STAG1
• Related Disease:
  Complex neurodevelopmental disorder
  Advanced cancer
  Benign prostatic hyperplasia
  Bladder cancer
  Breast cancer
  Breast carcinoma
  Clear cell renal carcinoma
  Colonic neoplasm
  Colorectal carcinoma
  Dental caries
  Epithelial ovarian cancer
  Ewing sarcoma
  Intellectual disability
  Intellectual disability, autosomal dominant 47
  Neoplasm
  Ovarian cancer
  Ovarian neoplasm
  Polyposis
  Prostate cancer
  Prostate carcinoma
  Renal cell carcinoma
  Rheumatoid arthritis
  Schizophrenia
  Squamous cell carcinoma
  Urinary bladder cancer
  Urinary bladder neoplasm
  Cornelia de Lange syndrome
  Coronary heart disease
• UniProt ID: STAG1_HUMAN
• PDB ID: 5QSM; 5QSN; 5QSO; 5QSP; 5QSQ; 5QSR; 5QSS; 5QST; 5QSU; 5QSV; 5QSW; 5QSX; 5QSY; 5QSZ; 6QB5; 6R7O; 6RRC; 6RRK; 6WG3; 7W1M
• Pfam ID: PF21581 ; PF08514
• Sequence:
  MITSELPVLQDSTNETTAHSDAGSELEETEVKGKRKRGRPGRPPSTNKKPRKSPGEKSRI
  EAGIRGAGRGRANGHPQQNGEGEPVTLFEVVKLGKSAMQSVVDDWIESYKQDRDIALLDL
  INFFIQCSGCRGTVRIEMFRNMQNAEIIRKMTEEFDEDSGDYPLTMPGPQWKKFRSNFCE
  FIGVLIRQCQYSIIYDEYMMDTVISLLTGLSDSQVRAFRHTSTLAAMKLMTALVNVALNL
  SIHQDNTQRQYEAERNKMIGKRANERLELLLQKRKELQENQDEIENMMNSIFKGIFVHRY
  RDAIAEIRAICIEEIGVWMKMYSDAFLNDSYLKYVGWTLHDRQGEVRLKCLKALQSLYTN
  RELFPKLELFTNRFKDRIVSMTLDKEYDVAVEAIRLVTLILHGSEEALSNEDCENVYHLV
  YSAHRPVAVAAGEFLHKKLFSRHDPQAEEALAKRRGRNSPNGNLIRMLVLFFLESELHEH
  AAYLVDSLWESSQELLKDWECMTELLLEEPVQGEEAMSDRQESALIELMVCTIRQAAEAH
  PPVGRGTGKRVLTAKERKTQIDDRNKLTEHFIITLPMLLSKYSADAEKVANLLQIPQYFD
  LEIYSTGRMEKHLDALLKQIKFVVEKHVESDVLEACSKTYSILCSEEYTIQNRVDIARSQ
  LIDEFVDRFNHSVEDLLQEGEEADDDDIYNVLSTLKRLTSFHNAHDLTKWDLFGNCYRLL
  KTGIEHGAMPEQIVVQALQCSHYSILWQLVKITDGSPSKEDLLVLRKTVKSFLAVCQQCL
  SNVNTPVKEQAFMLLCDLLMIFSHQLMTGGREGLQPLVFNPDTGLQSELLSFVMDHVFID
  QDEENQSMEGDEEDEANKIEALHKRRNLLAAFSKLIIYDIVDMHAAADIFKHYMKYYNDY
  GDIIKETLSKTRQIDKIQCAKTLILSLQQLFNELVQEQGPNLDRTSAHVSGIKELARRFA
  LTFGLDQIKTREAVATLHKDGIEFAFKYQNQKGQEYPPPNLAFLEVLSEFSSKLLRQDKK
  TVHSYLEKFLTEQMMERREDVWLPLISYRNSLVTGGEDDRMSVNSGSSSSKTSSVRNKKG
  RPPLHKKRVEDESLDNTWLNRTDTMIQTPGPLPAPQLTSTVLRENSRPMGDQIQEPESEH
  GSEPDFLHNPQMQISWLGQPKLEDLNRKDRTGMNYMKVRTGVRHAVRGLMEEDAEPIFED
  VMMSSRSQLEDMNEEFEDTMVIDLPPSRNRRERAELRPDFFDSAAIIEDDSGFGMPMF
• Function: Component of cohesin complex, a complex required for the cohesion of sister chromatids after DNA replication. The cohesin complex apparently forms a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. The cohesin complex may also play a role in spindle pole assembly during mitosis.
• KEGG Pathway: Cell cycle (hsa04110)
• Reactome Pathway:
  Separation of Sister Chromatids (R-HSA-2467813)
  Establishment of Sister Chromatid Cohesion (R-HSA-2468052)
  Cohesin Loading onto Chromatin (R-HSA-2470946)
  Resolution of Sister Chromatid Cohesion (R-HSA-2500257)
  SUMOylation of DNA damage response and repair proteins (R-HSA-3108214)
  Estrogen-dependent gene expression (R-HSA-9018519)
  Meiotic synapsis (R-HSA-1221632)

Molecular Interaction Atlas (MIA) of This DOT

28 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Complex neurodevelopmental disorder	DISB9AFI	Definitive	Autosomal dominant	[1]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[2]
Benign prostatic hyperplasia	DISI3CW2	Strong	Altered Expression	[3]
Bladder cancer	DISUHNM0	Strong	Altered Expression	[2]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[4]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[4]
Clear cell renal carcinoma	DISBXRFJ	Strong	Altered Expression	[5]
Colonic neoplasm	DISSZ04P	Strong	Genetic Variation	[6]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[7]
Dental caries	DISRBCMD	Strong	Genetic Variation	[8]
Epithelial ovarian cancer	DIS56MH2	Strong	Altered Expression	[4]
Ewing sarcoma	DISQYLV3	Strong	Altered Expression	[2]
Intellectual disability	DISMBNXP	Strong	Biomarker	[9]
Intellectual disability, autosomal dominant 47	DISQ9X80	Strong	Autosomal dominant	[10]
Neoplasm	DISZKGEW	Strong	Biomarker	[11]
Ovarian cancer	DISZJHAP	Strong	Altered Expression	[4]
Ovarian neoplasm	DISEAFTY	Strong	Altered Expression	[4]
Polyposis	DISZSPOK	Strong	Genetic Variation	[6]
Prostate cancer	DISF190Y	Strong	Altered Expression	[3]
Prostate carcinoma	DISMJPLE	Strong	Altered Expression	[3]
Renal cell carcinoma	DISQZ2X8	Strong	Altered Expression	[5]
Rheumatoid arthritis	DISTSB4J	Strong	Genetic Variation	[12]
Schizophrenia	DISSRV2N	Strong	Genetic Variation	[13]
Squamous cell carcinoma	DISQVIFL	Strong	Biomarker	[14]
Urinary bladder cancer	DISDV4T7	Strong	Altered Expression	[2]
Urinary bladder neoplasm	DIS7HACE	Strong	Altered Expression	[2]
Cornelia de Lange syndrome	DISEQSXO	moderate	Genetic Variation	[15]
Coronary heart disease	DIS5OIP1	moderate	Genetic Variation	[16]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Cohesin subunit SA-1 (STAG1).	[17]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Cohesin subunit SA-1 (STAG1).	[29]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Cohesin subunit SA-1 (STAG1).	[30]

17 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Cohesin subunit SA-1 (STAG1).	[18]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Cohesin subunit SA-1 (STAG1).	[19]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Cohesin subunit SA-1 (STAG1).	[20]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Cohesin subunit SA-1 (STAG1).	[21]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Cohesin subunit SA-1 (STAG1).	[22]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Cohesin subunit SA-1 (STAG1).	[23]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Cohesin subunit SA-1 (STAG1).	[24]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Cohesin subunit SA-1 (STAG1).	[25]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Cohesin subunit SA-1 (STAG1).	[26]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Cohesin subunit SA-1 (STAG1).	[27]
Afimoxifene	DMFORDT	Phase 2	Afimoxifene increases the expression of Cohesin subunit SA-1 (STAG1).	[28]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Cohesin subunit SA-1 (STAG1).	[31]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Cohesin subunit SA-1 (STAG1).	[32]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Cohesin subunit SA-1 (STAG1).	[33]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Cohesin subunit SA-1 (STAG1).	[34]
GALLICACID	DM6Y3A0	Investigative	GALLICACID decreases the expression of Cohesin subunit SA-1 (STAG1).	[35]
OXYBENZONE	DMMZYX6	Investigative	OXYBENZONE increases the expression of Cohesin subunit SA-1 (STAG1).	[21]

References

• [1] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [2] Synthetic lethality between the cohesin subunits STAG1 and STAG2 in diverse cancer contexts.Elife. 2017 Jul 10;6:e26980. doi: 10.7554/eLife.26980.
• [3] Prostate--specific G protein couple receptor genes and STAG1/PMEPA1 in peripheral blood from patients with prostatic cancer.Int J Immunopathol Pharmacol. 2006 Oct-Dec;19(4):871-8. doi: 10.1177/039463200601900416.
• [4] EGF- and cell-cycle-regulated STAG1/PMEPA1/ERG1.2 belongs to a conserved gene family and is overexpressed and amplified in breast and ovarian cancer.Mol Carcinog. 2003 Dec;38(4):188-200. doi: 10.1002/mc.10162.
• [5] Characterization of a novel gene, STAG1/PMEPA1, upregulated in renal cell carcinoma and other solid tumors.Mol Carcinog. 2001 Sep;32(1):44-53. doi: 10.1002/mc.1063.
• [6] Genome-wide association and fine mapping of genetic loci predisposing to colon carcinogenesis in mice.Mol Cancer Res. 2012 Jan;10(1):66-74. doi: 10.1158/1541-7786.MCR-10-0540. Epub 2011 Nov 29.
• [7] Single Nucleotide Polymorphism Facilitated Down-Regulation of the Cohesin Stromal Antigen-1: Implications for Colorectal Cancer Racial Disparities.Neoplasia. 2018 Mar;20(3):289-294. doi: 10.1016/j.neo.2018.01.003. Epub 2018 Feb 19.
• [8] Genome-wide analysis of dental caries and periodontitis combining clinical and self-reported data.Nat Commun. 2019 Jun 24;10(1):2773. doi: 10.1038/s41467-019-10630-1.
• [9] Targeted sequencing identifies 91 neurodevelopmental-disorder risk genes with autism and developmental-disability biases. Nat Genet. 2017 Apr;49(4):515-526. doi: 10.1038/ng.3792. Epub 2017 Feb 13.
• [10] STAG1 mutations cause a novel cohesinopathy characterised by unspecific syndromic intellectual disability. J Med Genet. 2017 Jul;54(7):479-488. doi: 10.1136/jmedgenet-2016-104468. Epub 2017 Jan 24.
• [11] Synthetic lethal interaction between the tumour suppressor STAG2 and its paralog STAG1.Oncotarget. 2017 Jun 6;8(23):37619-37632. doi: 10.18632/oncotarget.16838.
• [12] Genetic influences on susceptibility to rheumatoid arthritis in African-Americans.Hum Mol Genet. 2019 Mar 1;28(5):858-874. doi: 10.1093/hmg/ddy395.
• [13] Genome-Wide Association Study Detected Novel Susceptibility Genes for Schizophrenia and Shared Trans-Populations/Diseases Genetic Effect.Schizophr Bull. 2019 Jun 18;45(4):824-834. doi: 10.1093/schbul/sby140.
• [14] Expression of c-erbB2 and c-myc in squamous epithelia and squamous cell carcinomas of the head and neck and the lower female genital tract.J Oral Pathol Med. 1990 Oct;19(9):408-13. doi: 10.1111/j.1600-0714.1990.tb00869.x.
• [15] Clinical exome sequencing reveals locus heterogeneity and phenotypic variability of cohesinopathies.Genet Med. 2019 Mar;21(3):663-675. doi: 10.1038/s41436-018-0085-6. Epub 2018 Aug 30.
• [16] Identification of 64 Novel Genetic Loci Provides an Expanded View on the Genetic Architecture of Coronary Artery Disease.Circ Res. 2018 Feb 2;122(3):433-443. doi: 10.1161/CIRCRESAHA.117.312086. Epub 2017 Dec 6.
• [17] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [18] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [19] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [20] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [21] Chromatin modifiers: A new class of pollutants with potential epigenetic effects revealed by in vitro assays and transcriptomic analyses. Toxicology. 2023 Jan 15;484:153413. doi: 10.1016/j.tox.2022.153413. Epub 2022 Dec 26.
• [22] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [23] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [24] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [25] A genomic approach to predict synergistic combinations for breast cancer treatment. Pharmacogenomics J. 2013 Feb;13(1):94-104. doi: 10.1038/tpj.2011.48. Epub 2011 Nov 15.
• [26] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [27] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [28] Gene expression preferentially regulated by tamoxifen in breast cancer cells and correlations with clinical outcome. Cancer Res. 2006 Jul 15;66(14):7334-40.
• [29] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [30] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [31] Environmental pollutant induced cellular injury is reflected in exosomes from placental explants. Placenta. 2020 Jan 1;89:42-49. doi: 10.1016/j.placenta.2019.10.008. Epub 2019 Oct 17.
• [32] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [33] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [34] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [35] Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.