Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT5Y03EU)

• DOT Name: Contactin-associated protein 1 (CNTNAP1)
• Synonyms: Caspr; Caspr1; Neurexin IV; Neurexin-4; p190
• Gene Name: CNTNAP1
• Related Disease:
  Acute lymphocytic leukaemia
  Acute monocytic leukemia
  Acute myelogenous leukaemia
  Adenocarcinoma
  Advanced cancer
  Anthrax
  Arthrogryposis
  B-cell acute lymphoblastic leukaemia
  Breast carcinoma
  Childhood acute lymphoblastic leukemia
  Childhood myelodysplastic syndrome
  Chronic inflammatory demyelinating polyneuropathy
  Demyelinating polyneuropathy
  Essential thrombocythemia
  Hemangioma
  Hydrocephalus
  Lethal congenital contracture syndrome 7
  leukaemia
  Leukemia
  Major depressive disorder
  Mantle cell lymphoma
  Microcephaly
  Multiple sclerosis
  Myelodysplastic syndrome
  Neuropathy, congenital hypomelinating
  Plasmodium falciparum malaria
  Primary myelofibrosis
  Promyelocytic leukaemia
  Ptosis
  Autism
  Chronic myelomonocytic leukemia
  Neurodevelopmental disorder
  Obsolete hypomyelination neuropathy-arthrogryposis syndrome
  Acute leukaemia
  Adult lymphoma
  Lymphoid leukemia
  Lymphoma
  Malaria
  Meningitis
  Myeloproliferative neoplasm
  Neoplasm
  Pediatric lymphoma
• UniProt ID: CNTP1_HUMAN
• Pfam ID: PF00754 ; PF02210
• Sequence:
  MMHLRLFCILLAAVSGAEGWGYYGCDEELVGPLYARSLGASSYYSLLTAPRFARLHGISG
  WSPRIGDPNPWLQIDLMKKHRIRAVATQGSFNSWDWVTRYMLLYGDRVDSWTPFYQRGHN
  STFFGNVNESAVVRHDLHFHFTARYIRIVPLAWNPRGKIGLRLGLYGCPYKADILYFDGD
  DAISYRFPRGVSRSLWDVFAFSFKTEEKDGLLLHAEGAQGDYVTLELEGAHLLLHMSLGS
  SPIQPRPGHTTVSAGGVLNDQHWHYVRVDRFGRDVNFTLDGYVQRFILNGDFERLNLDTE
  MFIGGLVGAARKNLAYRHNFRGCIENVIFNRVNIADLAVRRHSRITFEGKVAFRCLDPVP
  HPINFGGPHNFVQVPGFPRRGRLAVSFRFRTWDLTGLLLFSRLGDGLGHVELTLSEGQVN
  VSIAQSGRKKLQFAAGYRLNDGFWHEVNFVAQENHAVISIDDVEGAEVRVSYPLLIRTGT
  SYFFGGCPKPASRWDCHSNQTAFHGCMELLKVDGQLVNLTLVEGRRLGFYAEVLFDTCGI
  TDRCSPNMCEHDGRCYQSWDDFICYCELTGYKGETCHTPLYKESCEAYRLSGKTSGNFTI
  DPDGSGPLKPFVVYCDIRENRAWTVVRHDRLWTTRVTGSSMERPFLGAIQYWNASWEEVS
  ALANASQHCEQWIEFSCYNSRLLNTAGGYPYSFWIGRNEEQHFYWGGSQPGIQRCACGLD
  RSCVDPALYCNCDADQPQWRTDKGLLTFVDHLPVTQVVIGDTNRSTSEAQFFLRPLRCYG
  DRNSWNTISFHTGAALRFPPIRANHSLDVSFYFRTSAPSGVFLENMGGPYCQWRRPYVRV
  ELNTSRDVVFAFDVGNGDENLTVHSDDFEFNDDEWHLVRAEINVKQARLRVDHRPWVLRP
  MPLQTYIWMEYDQPLYVGSAELKRRPFVGCLRAMRLNGVTLNLEGRANASEGTSPNCTGH
  CAHPRLPCFHGGRCVERYSYYTCDCDLTAFDGPYCNHDIGGFFEPGTWMRYNLQSALRSA
  AREFSHMLSRPVPGYEPGYIPGYDTPGYVPGYHGPGYRLPDYPRPGRPVPGYRGPVYNVT
  GEEVSFSFSTSSAPAVLLYVSSFVRDYMAVLIKDDGTLQLRYQLGTSPYVYQLTTRPVTD
  GQPHSINITRVYRNLFIQVDYFPLTEQKFSLLVDSQLDSPKALYLGRVMETGVIDPEIQR
  YNTPGFSGCLSGVRFNNVAPLKTHFRTPRPMTAELAEALRVQGELSESNCGAMPRLVSEV
  PPELDPWYLPPDFPYYHDEGWVAILLGFLVAFLLLGLVGMLVLFYLQNHRYKGSYHTNEP
  KAAHEYHPGSKPPLPTSGPAQVPTPTAAPNQAPASAPAPAPTPAPAPGPRDQNLPQILEE
  SRSE
• Function: Required, with CNTNAP2, for radial and longitudinal organization of myelinated axons. Plays a role in the formation of functional distinct domains critical for saltatory conduction of nerve impulses in myelinated nerve fibers. Demarcates the paranodal region of the axo-glial junction. In association with contactin involved in the signaling between axons and myelinating glial cells.
• Tissue Specificity: Predominantly expressed in brain. Weak expression detected in ovary, pancreas, colon, lung, heart, intestine and testis.
• KEGG Pathway: Cell adhesion molecules (hsa04514)
• Reactome Pathway: Neurofascin interactions (R-HSA-447043)

Molecular Interaction Atlas (MIA) of This DOT

42 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acute lymphocytic leukaemia	DISPX75S	Strong	Biomarker	[1]
Acute monocytic leukemia	DIS28NEL	Strong	Genetic Variation	[2]
Acute myelogenous leukaemia	DISCSPTN	Strong	Altered Expression	[3]
Adenocarcinoma	DIS3IHTY	Strong	Altered Expression	[4]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[5]
Anthrax	DISFPT78	Strong	Genetic Variation	[6]
Arthrogryposis	DISC81CM	Strong	Biomarker	[7]
B-cell acute lymphoblastic leukaemia	DISKLOKC	Strong	Genetic Variation	[8]
Breast carcinoma	DIS2UE88	Strong	Genetic Variation	[9]
Childhood acute lymphoblastic leukemia	DISJ5D6U	Strong	Biomarker	[1]
Childhood myelodysplastic syndrome	DISMN80I	Strong	Genetic Variation	[10]
Chronic inflammatory demyelinating polyneuropathy	DISNGBLD	Strong	Biomarker	[11]
Demyelinating polyneuropathy	DIS7IO4W	Strong	Biomarker	[7]
Essential thrombocythemia	DISWWK11	Strong	Biomarker	[12]
Hemangioma	DISDCGAG	Strong	Genetic Variation	[13]
Hydrocephalus	DISIZUF7	Strong	Genetic Variation	[13]
Lethal congenital contracture syndrome 7	DISEXA73	Strong	Autosomal recessive	[14]
leukaemia	DISS7D1V	Strong	Biomarker	[15]
Leukemia	DISNAKFL	Strong	Biomarker	[15]
Major depressive disorder	DIS4CL3X	Strong	Genetic Variation	[16]
Mantle cell lymphoma	DISFREOV	Strong	Biomarker	[17]
Microcephaly	DIS2GRD8	Strong	Genetic Variation	[13]
Multiple sclerosis	DISB2WZI	Strong	Biomarker	[18]
Myelodysplastic syndrome	DISYHNUI	Strong	Genetic Variation	[10]
Neuropathy, congenital hypomelinating	DISZUW4L	Strong	Biomarker	[19]
Plasmodium falciparum malaria	DIS3Q9KF	Strong	Biomarker	[20]
Primary myelofibrosis	DIS6L0CN	Strong	Genetic Variation	[21]
Promyelocytic leukaemia	DISYGG13	Strong	Altered Expression	[4]
Ptosis	DISJZNIY	Strong	Genetic Variation	[13]
Autism	DISV4V1Z	moderate	Genetic Variation	[22]
Chronic myelomonocytic leukemia	DISIL8UR	moderate	Genetic Variation	[21]
Neurodevelopmental disorder	DIS372XH	moderate	Genetic Variation	[22]
Obsolete hypomyelination neuropathy-arthrogryposis syndrome	DISO9PZY	Supportive	Autosomal recessive	[23]
Acute leukaemia	DISDQFDI	Limited	Altered Expression	[24]
Adult lymphoma	DISK8IZR	Limited	Biomarker	[25]
Lymphoid leukemia	DIS65TYQ	Limited	Biomarker	[1]
Lymphoma	DISN6V4S	Limited	Biomarker	[25]
Malaria	DISQ9Y50	Limited	Biomarker	[26]
Meningitis	DISQABAA	Limited	Biomarker	[27]
Myeloproliferative neoplasm	DIS5KAPA	Limited	Genetic Variation	[28]
Neoplasm	DISZKGEW	Limited	Biomarker	[29]
Pediatric lymphoma	DIS51BK2	Limited	Biomarker	[25]

13 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Contactin-associated protein 1 (CNTNAP1).	[30]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Contactin-associated protein 1 (CNTNAP1).	[31]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Contactin-associated protein 1 (CNTNAP1).	[32]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Contactin-associated protein 1 (CNTNAP1).	[33]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Contactin-associated protein 1 (CNTNAP1).	[34]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Contactin-associated protein 1 (CNTNAP1).	[32]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Contactin-associated protein 1 (CNTNAP1).	[35]
DTI-015	DMXZRW0	Approved	DTI-015 increases the expression of Contactin-associated protein 1 (CNTNAP1).	[36]
Mifepristone	DMGZQEF	Approved	Mifepristone decreases the expression of Contactin-associated protein 1 (CNTNAP1).	[37]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Contactin-associated protein 1 (CNTNAP1).	[38]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Contactin-associated protein 1 (CNTNAP1).	[40]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Contactin-associated protein 1 (CNTNAP1).	[42]
Pyrrolidine dithiocarbamate	DM5ZAS6	Investigative	Pyrrolidine dithiocarbamate increases the expression of Contactin-associated protein 1 (CNTNAP1).	[43]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Contactin-associated protein 1 (CNTNAP1).	[39]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Contactin-associated protein 1 (CNTNAP1).	[41]

References

• [1] Pak1 gene functioned differentially in different BCR-ABL subtypes in leukemiagenesis and treatment response through STAT5 pathway.Leuk Res. 2019 Apr;79:6-16. doi: 10.1016/j.leukres.2019.01.012. Epub 2019 Jan 24.
• [2] Establishment of a novel human myeloid leukaemia cell line (HNT-34) with t(3;3)(q21;q26), t(9;22)(q34;q11) and the expression of EVI1 gene, P210 and P190 BCR/ABL chimaeric transcripts from a patient with AML after MDS with 3q21q26 syndrome.Br J Haematol. 1997 Aug;98(2):399-407. doi: 10.1046/j.1365-2141.1997.2143029.x.
• [3] A rare BCR-ABL1 transcript in Philadelphia-positive acute myeloid leukemia: case report and literature review.BMC Cancer. 2019 Jan 10;19(1):50. doi: 10.1186/s12885-019-5265-5.
• [4] Non-P-glycoprotein multidrug resistance in cell lines which are defective in the cellular accumulation of drug.Cytotechnology. 1993;12(1-3):109-25. doi: 10.1007/BF00744660.
• [5] Inactivation of Rho GTPases by p190 RhoGAP reduces human pancreatic cancer cell invasion and metastasis.Cancer Sci. 2006 Sep;97(9):848-53. doi: 10.1111/j.1349-7006.2006.00242.x. Epub 2006 Jun 14.
• [6] Genetic characteristics of Bacillus anthracis isolated from northwestern China from 1990 to 2016.PLoS Negl Trop Dis. 2018 Nov 12;12(11):e0006908. doi: 10.1371/journal.pntd.0006908. eCollection 2018 Nov.
• [7] Absence of Axoglial Paranodal Junctions in a Child With CNTNAP1 Mutations, Hypomyelination, and Arthrogryposis.J Child Neurol. 2018 Sep;33(10):642-650. doi: 10.1177/0883073818776157. Epub 2018 Jun 8.
• [8] Ph1-chromosome positive acute lymphoblastic leukemia: is t(9;22) the initial abnormality?.Am J Hematol. 1993 May;43(1):61-2. doi: 10.1002/ajh.2830430115.
• [9] Association analysis identifies 65 new breast cancer risk loci.Nature. 2017 Nov 2;551(7678):92-94. doi: 10.1038/nature24284. Epub 2017 Oct 23.
• [10] Progression from myelodysplastic syndrome to acute lymphoblastic leukaemia with Philadelphia chromosome and p190 BCR-ABL transcript.Br J Haematol. 1996 May;93(2):389-91. doi: 10.1046/j.1365-2141.1996.4931034.x.
• [11] Chronic inflammatory demyelinating polyneuropathy with anti-NF155 IgG4 in China.J Neuroimmunol. 2019 Dec 15;337:577074. doi: 10.1016/j.jneuroim.2019.577074. Epub 2019 Oct 25.
• [12] Concomitant presence of JAK2V617F mutation and BCRABL translocation in two patients: A new entity or a variant of myeloproliferative neoplasms (Case report).Mol Med Rep. 2018 Jul;18(1):1001-1006. doi: 10.3892/mmr.2018.9032. Epub 2018 May 17.
• [13] Novel mutation in CNTNAP1 results in congenital hypomyelinating neuropathy.Muscle Nerve. 2017 May;55(5):761-765. doi: 10.1002/mus.25416. Epub 2017 Feb 3.
• [14] Axon-glia interactions and the domain organization of myelinated axons requires neurexin IV/Caspr/Paranodin. Neuron. 2001 May;30(2):369-83. doi: 10.1016/s0896-6273(01)00294-x.
• [15] BCR/ABL P190 transgenic mice develop leukemia in the absence of Crkl.Oncogene. 2002 May 9;21(20):3225-31. doi: 10.1038/sj.onc.1205452.
• [16] The PHF21B gene is associated with major depression and modulates the stress response.Mol Psychiatry. 2017 Jul;22(7):1015-1025. doi: 10.1038/mp.2016.174. Epub 2016 Oct 25.
• [17] Molecular hematology. Qualitative to quantitative techniques.Saudi Med J. 2005 Oct;26(10):1516-22.
• [18] Anti-neurofascin autoantibody and demyelination.Neurochem Int. 2019 Nov;130:104360. doi: 10.1016/j.neuint.2018.12.011. Epub 2018 Dec 22.
• [19] CNTNAP1-Related Congenital Hypomyelinating Neuropathy.Pediatr Neurol. 2019 Apr;93:43-49. doi: 10.1016/j.pediatrneurol.2018.12.014. Epub 2018 Dec 28.
• [20] Major surface antigen gene of a human malaria parasite cloned and expressed in bacteria.Nature. 1984 Sep 27-Oct 3;311(5984):379-82. doi: 10.1038/311379a0.
• [21] p190 bcr-abl rearrangement: a secondary cytogenetic event in some chronic myeloid disorders?.Haematologica. 1999 Dec;84(12):1075-80.
• [22] Contactin 4 as an autism susceptibility locus.Autism Res. 2011 Jun;4(3):189-99. doi: 10.1002/aur.184. Epub 2011 Feb 9.
• [23] Mutations in CNTNAP1 and ADCY6 are responsible for severe arthrogryposis multiplex congenita with axoglial defects. Hum Mol Genet. 2014 May 1;23(9):2279-89. doi: 10.1093/hmg/ddt618. Epub 2013 Dec 6.
• [24] Inversion of chromosome 16 with the Philadelphia chromosome in acute myelomonocytic leukemia with eosinophilia. Report of two cases.Cancer Genet Cytogenet. 1992 Jan;58(1):29-34. doi: 10.1016/0165-4608(92)90129-v.
• [25] Reduced oncogenicity of p190 Bcr/Abl F-actin-binding domain mutants.Blood. 2000 Sep 15;96(6):2226-32.
• [26] Processing, polymorphism, and biological significance of P190, a major surface antigen of the erythrocytic forms of Plasmodium falciparum.Mol Biochem Parasitol. 1984 Apr;11:61-80. doi: 10.1016/0166-6851(84)90055-0.
• [27] Caspr1 is a host receptor for meningitis-causing Escherichia coli.Nat Commun. 2018 Jun 12;9(1):2296. doi: 10.1038/s41467-018-04637-3.
• [28] Unique Case of Myeloproliferative Neoplasm with Two Rare Clonal Abnormalities: Rare JAK2 Exon 12 Mutation and Rare e14a3 (b3a3) BCR/ABL Fusion Transcript.Acta Haematol. 2019;141(1):23-27. doi: 10.1159/000494427. Epub 2018 Nov 21.
• [29] p190RhoGAP can act to inhibit PDGF-induced gliomas in mice: a putative tumor suppressor encoded on human chromosome 19q13.3.Genes Dev. 2003 Feb 15;17(4):476-87. doi: 10.1101/gad.1040003.
• [30] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [31] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [32] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [33] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [34] Gene expression profile induced by arsenic trioxide in chronic lymphocytic leukemia cells reveals a central role for heme oxygenase-1 in apoptosis and regulation of matrix metalloproteinase-9. Oncotarget. 2016 Dec 13;7(50):83359-83377.
• [35] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [36] Gene expression profile induced by BCNU in human glioma cell lines with differential MGMT expression. J Neurooncol. 2005 Jul;73(3):189-98.
• [37] Mifepristone induced progesterone withdrawal reveals novel regulatory pathways in human endometrium. Mol Hum Reprod. 2007 Sep;13(9):641-54.
• [38] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [39] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [40] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [41] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [42] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [43] Effects of a redox-active agent on lymphocyte activation and early gene expression patterns. Free Radic Biol Med. 2004 Nov 15;37(10):1550-63.