Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT7364GY)

DOT Name	Malate dehydrogenase, mitochondrial (MDH2)
Synonyms	EC 1.1.1.37
Gene Name	MDH2
Related Disease	Cardiac failure ( ) Drug dependence ( ) Adrenocortical carcinoma ( ) Alzheimer disease ( ) Analgesia ( ) Congenital adrenal hyperplasia ( ) Congestive heart failure ( ) Depression ( ) Developmental and epileptic encephalopathy, 51 ( ) Endometrial cancer ( ) Endometrial carcinoma ( ) Epithelial ovarian cancer ( ) Malignant uterine tumour ( ) Melanoma ( ) Myocardial infarction ( ) Neoplasm ( ) Nephropathy ( ) Neuralgia ( ) Non-small-cell lung cancer ( ) Pheochromocytoma ( ) Prostate cancer ( ) Prostate carcinoma ( ) Advanced cancer ( ) Gastritis ( ) Hereditary pheochromocytoma-paraganglioma ( ) Brucellosis ( ) Carcinoma ( ) Minimally invasive lung adenocarcinoma ( ) Paraganglioma ( ) Undifferentiated carcinoma ( )
UniProt ID	MDHM_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	2DFD; 4WLE; 4WLF; 4WLN; 4WLO; 4WLU; 4WLV
EC Number	1.1.1.37
Pfam ID	PF02866 ; PF00056
Sequence	MLSALARPASAALRRSFSTSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAH TPGVAADLSHIETKAAVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATI VATLTAACAQHCPEAMICVIANPVNSTIPITAEVFKKHGVYNPNKIFGVTTLDIVRANTF VAELKGLDPARVNVPVIGGHAGKTIIPLISQCTPKVDFPQDQLTALTGRIQEAGTEVVKA KAGAGSATLSMAYAGARFVFSLVDAMNGKEGVVECSFVKSQETECTYFSTPLLLGKKGIE KNLGIGKVSSFEEKMISDAIPELKASIKKGEDFVKTLK
KEGG Pathway	Citrate cycle (TCA cycle) (hsa00020 ) Cysteine and methionine metabolism (hsa00270 ) Pyruvate metabolism (hsa00620 ) Glyoxylate and dicarboxylate metabolism (hsa00630 ) Metabolic pathways (hsa01100 ) Carbon metabolism (hsa01200 )
Reactome Pathway	Citric acid cycle (TCA cycle) (R-HSA-71403 ) Gluconeogenesis (R-HSA-70263 )
BioCyc Pathway	MetaCyc:HS07366-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

30 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Cardiac failure	DISDC067	Definitive	Biomarker	[1]
Drug dependence	DIS9IXRC	Definitive	Genetic Variation	[2]
Adrenocortical carcinoma	DISZF4HX	Strong	Biomarker	[3]
Alzheimer disease	DISF8S70	Strong	Altered Expression	[4]
Analgesia	DISK3TVI	Strong	Genetic Variation	[5]
Congenital adrenal hyperplasia	DISG873W	Strong	Biomarker	[3]
Congestive heart failure	DIS32MEA	Strong	Biomarker	[1]
Depression	DIS3XJ69	Strong	Biomarker	[6]
Developmental and epileptic encephalopathy, 51	DIS32JMY	Strong	Autosomal recessive	[7]
Endometrial cancer	DISW0LMR	Strong	Altered Expression	[8]
Endometrial carcinoma	DISXR5CY	Strong	Altered Expression	[8]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[9]
Malignant uterine tumour	DIS3QDT8	Strong	Biomarker	[10]
Melanoma	DIS1RRCY	Strong	Biomarker	[11]
Myocardial infarction	DIS655KI	Strong	Biomarker	[12]
Neoplasm	DISZKGEW	Strong	Biomarker	[13]
Nephropathy	DISXWP4P	Strong	Biomarker	[14]
Neuralgia	DISWO58J	Strong	Altered Expression	[15]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[16]
Pheochromocytoma	DIS56IFV	Strong	Genetic Variation	[17]
Prostate cancer	DISF190Y	Strong	Biomarker	[18]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[18]
Advanced cancer	DISAT1Z9	moderate	Altered Expression	[8]
Gastritis	DIS8G07K	moderate	Altered Expression	[19]
Hereditary pheochromocytoma-paraganglioma	DISP9K7L	Supportive	Autosomal dominant	[13]
Brucellosis	DISEAYGH	Disputed	Biomarker	[20]
Carcinoma	DISH9F1N	Limited	Biomarker	[21]
Minimally invasive lung adenocarcinoma	DIS4W83X	Limited	Altered Expression	[22]
Paraganglioma	DIS2XXH5	Limited	Genetic Variation	[17]
Undifferentiated carcinoma	DISIAZST	Limited	Biomarker	[21]
------------------------------------------------------------------------------------


⏷ Show the Full List of 30 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

15 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Malate dehydrogenase, mitochondrial (MDH2).	[23]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Malate dehydrogenase, mitochondrial (MDH2).	[24]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Malate dehydrogenase, mitochondrial (MDH2).	[25]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Malate dehydrogenase, mitochondrial (MDH2).	[26]
Arsenic	DMTL2Y1	Approved	Arsenic increases the expression of Malate dehydrogenase, mitochondrial (MDH2).	[27]
Acocantherin	DM7JT24	Approved	Acocantherin affects the expression of Malate dehydrogenase, mitochondrial (MDH2).	[28]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate decreases the expression of Malate dehydrogenase, mitochondrial (MDH2).	[29]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Malate dehydrogenase, mitochondrial (MDH2).	[30]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Malate dehydrogenase, mitochondrial (MDH2).	[32]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Malate dehydrogenase, mitochondrial (MDH2).	[34]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the expression of Malate dehydrogenase, mitochondrial (MDH2).	[29]
Celastrol	DMWQIJX	Preclinical	Celastrol decreases the expression of Malate dehydrogenase, mitochondrial (MDH2).	[35]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Malate dehydrogenase, mitochondrial (MDH2).	[36]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Malate dehydrogenase, mitochondrial (MDH2).	[37]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the activity of Malate dehydrogenase, mitochondrial (MDH2).	[38]
------------------------------------------------------------------------------------


⏷ Show the Full List of 15 Drug(s)

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
DNCB	DMDTVYC	Phase 2	DNCB affects the binding of Malate dehydrogenase, mitochondrial (MDH2).	[31]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Malate dehydrogenase, mitochondrial (MDH2).	[33]
------------------------------------------------------------------------------------

References

1	Adriamycin induced myocardial failure in rats: protective role of Centella asiatica.Mol Cell Biochem. 2007 Jan;294(1-2):55-63. doi: 10.1007/s11010-006-9245-0. Epub 2006 Jun 20.
2	Functional interactions between endogenous cannabinoid and opioid systems: focus on alcohol, genetics and drug-addicted behaviors.Curr Drug Targets. 2010 Apr;11(4):406-28. doi: 10.2174/138945010790980312.
3	PRECISION MEDICINE IN ADRENAL DISORDERS: THE NEXT GENERATION.Endocr Pract. 2017 Jun;23(6):672-679. doi: 10.4158/EP161716.RA. Epub 2017 Mar 23.
4	Changes of hippocampus proteomic profiles after blueberry extracts supplementation in APP/PS1 transgenic mice.Nutr Neurosci. 2020 Jan;23(1):75-84. doi: 10.1080/1028415X.2018.1471251. Epub 2018 May 21.
5	Mediation of buprenorphine analgesia by a combination of traditional and truncated mu opioid receptor splice variants.Synapse. 2016 Oct;70(10):395-407. doi: 10.1002/syn.21914. Epub 2016 Jul 12.
6	Novel Metabolic Abnormalities in the Tricarboxylic Acid Cycle in Peripheral Cells From Huntington's Disease Patients.PLoS One. 2016 Sep 9;11(9):e0160384. doi: 10.1371/journal.pone.0160384. eCollection 2016.
7	Mutations in MDH2, Encoding a Krebs Cycle Enzyme, Cause Early-Onset Severe Encephalopathy. Am J Hum Genet. 2017 Jan 5;100(1):151-159. doi: 10.1016/j.ajhg.2016.11.014. Epub 2016 Dec 15.
8	MDH2 Stimulated by Estrogen-GPR30 Pathway Down-Regulated PTEN Expression Promoting the Proliferation and Invasion of Cells in Endometrial Cancer.Transl Oncol. 2017 Apr;10(2):203-210. doi: 10.1016/j.tranon.2017.01.009. Epub 2017 Feb 9.
9	In vivo loss-of-function screens identify KPNB1 as a new druggable oncogene in epithelial ovarian cancer.Proc Natl Acad Sci U S A. 2017 Aug 29;114(35):E7301-E7310. doi: 10.1073/pnas.1705441114. Epub 2017 Aug 15.
10	Mitochondrial proteomics with siRNA knockdown to reveal ACAT1 and MDH2 in the development of doxorubicin-resistant uterine cancer.J Cell Mol Med. 2015 Apr;19(4):744-59. doi: 10.1111/jcmm.12388. Epub 2015 Jan 30.
11	Linkage group V of platyfishes and Swordtails of the genus Xiphophorus (Poeciliidae): linkage of loci for malate dehydrogenase-2 and esterase-1 and esterase-4 with a gene controlling the severity of hybrid melanomas.J Natl Cancer Inst. 1983 Oct;71(4):809-13.
12	Dl-3-n-butylphthalide protects the heart against ischemic injury and H9c2 cardiomyoblasts against oxidative stress: involvement of mitochondrial function and biogenesis.J Biomed Sci. 2017 Jun 15;24(1):38. doi: 10.1186/s12929-017-0345-9.
13	Whole-exome sequencing identifies MDH2 as a new familial paraganglioma gene. J Natl Cancer Inst. 2015 Mar 11;107(5):djv053. doi: 10.1093/jnci/djv053.
14	Angiotensin receptor blocker vs ACE inhibitor effects on HDL functionality in patients on maintenance hemodialysis.Nutr Metab Cardiovasc Dis. 2018 Jun;28(6):582-591. doi: 10.1016/j.numecd.2018.02.020. Epub 2018 Mar 8.
15	Regulation of -opioid type 1 receptors by microRNA134 in dorsal root ganglion neurons following peripheral inflammation.Eur J Pain. 2013 Mar;17(3):313-23. doi: 10.1002/j.1532-2149.2012.00197.x. Epub 2012 Aug 3.
16	Characterization of the Role of the Malate Dehydrogenases to Lung Tumor Cell Survival.J Cancer. 2017 Jul 5;8(11):2088-2096. doi: 10.7150/jca.19373. eCollection 2017.
17	Role of MDH2 pathogenic variant in pheochromocytoma and paraganglioma patients.Genet Med. 2018 Dec;20(12):1652-1662. doi: 10.1038/s41436-018-0068-7. Epub 2018 Jul 16.
18	Alternol eliminates excessive ATP production by disturbing Krebs cycle in prostate cancer.Prostate. 2019 May;79(6):628-639. doi: 10.1002/pros.23767. Epub 2019 Jan 20.
19	Antibacterial and anti-atrophic effects of a highly soluble, acid stable UDCA formula in Helicobacter pylori-induced gastritis.Biochem Pharmacol. 2008 Jun 1;75(11):2135-46. doi: 10.1016/j.bcp.2008.03.008. Epub 2008 Mar 22.
20	Characterization of the immunogenicity and pathogenicity of malate dehydrogenase in Brucella abortus.World J Microbiol Biotechnol. 2014 Jul;30(7):2063-70. doi: 10.1007/s11274-014-1631-2. Epub 2014 Mar 8.
21	cDNA microarray profiling of rat mammary gland carcinomas induced by 2-amino-1-methyl-6-phenylimidazo[4,5-b]pyridine and 7,12-dimethylbenz[a]anthracene.Carcinogenesis. 2002 Oct;23(10):1561-8. doi: 10.1093/carcin/23.10.1561.
22	Overexpression of the -opioid receptor in human non-small cell lung cancer promotes Akt and mTOR activation, tumor growth, and metastasis.Anesthesiology. 2012 Apr;116(4):857-67. doi: 10.1097/ALN.0b013e31824babe2.
23	Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
24	Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
25	Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
26	Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
27	Nucleophosmin in the pathogenesis of arsenic-related bladder carcinogenesis revealed by quantitative proteomics. Toxicol Appl Pharmacol. 2010 Jan 15;242(2):126-35. doi: 10.1016/j.taap.2009.09.016. Epub 2009 Oct 7.
28	Proteomics analysis of the proliferative effect of low-dose ouabain on human endothelial cells. Biol Pharm Bull. 2007 Feb;30(2):247-53. doi: 10.1248/bpb.30.247.
29	Comparative proteomics reveals concordant and discordant biochemical effects of caffeine versus epigallocatechin-3-gallate in human endothelial cells. Toxicol Appl Pharmacol. 2019 Sep 1;378:114621. doi: 10.1016/j.taap.2019.114621. Epub 2019 Jun 10.
30	Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
31	Proteomic analysis of the cellular response to a potent sensitiser unveils the dynamics of haptenation in living cells. Toxicology. 2020 Dec 1;445:152603. doi: 10.1016/j.tox.2020.152603. Epub 2020 Sep 28.
32	New insights into BaP-induced toxicity: role of major metabolites in transcriptomics and contribution to hepatocarcinogenesis. Arch Toxicol. 2016 Jun;90(6):1449-58.
33	Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
34	Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
35	Gene expression signature-based chemical genomic prediction identifies a novel class of HSP90 pathway modulators. Cancer Cell. 2006 Oct;10(4):321-30.
36	Environmental pollutant induced cellular injury is reflected in exosomes from placental explants. Placenta. 2020 Jan 1;89:42-49. doi: 10.1016/j.placenta.2019.10.008. Epub 2019 Oct 17.
37	Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
38	Effect of soluble nickel on cellular energy metabolism in A549 cells. Exp Biol Med (Maywood). 2006 Oct;231(9):1474-80. doi: 10.1177/153537020623100905.