Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTB5I4OC)

• DOT Name: Monocyte to macrophage differentiation factor (MMD)
• Synonyms: Progestin and adipoQ receptor family member 11; Progestin and adipoQ receptor family member XI
• Gene Name: MMD
• Related Disease:
  Anemia
  Arteriosclerosis
  Atherosclerosis
  Breast cancer
  Breast carcinoma
  High blood pressure
  Lung cancer
  Lung carcinoma
  Metabolic disorder
  Methylmalonic acidemia
  Moyamoya disease
  Muscular dystrophy
  Neoplasm
  Nephropathy
  Non-alcoholic fatty liver disease
  Non-small-cell lung cancer
  Obstructive sleep apnea
  Scott syndrome
  Systemic sclerosis
  Transitional cell carcinoma
  Urothelial carcinoma
  Vascular disease
  Vitamin B12 deficiency
  Limb-girdle muscular dystrophy
  Optic nerve disorder
  Migraine disorder
  Arrhythmia
  Coronary heart disease
  Generalized anxiety disorder
  Lung squamous cell carcinoma
  Myotonic dystrophy
• UniProt ID: PAQRB_HUMAN
• Pfam ID: PF03006
• Sequence:
  MRFKNRFQRFMNHRAPANGRYKPTCYEHAANCYTHAFLIVPAIVGSALLHRLSDDCWEKI
  TAWIYGMGLCALFIVSTVFHIVSWKKSHLRTVEHCFHMCDRMVIYFFIAASYAPWLNLRE
  LGPLASHMRWFIWLMAAGGTIYVFLYHEKYKVVELFFYLTMGFSPALVVTSMNNTDGLQE
  LACGGLIYCLGVVFFKSDGIIPFAHAIWHLFVATAAAVHYYAIWKYLYRSPTDFMRHL
• Function: Involved in the dynamics of lysosomal membranes associated with microglial activation following brain lesion.
• Tissue Specificity: Exhibits relatively ubiquitous expression with preferential expression in mature (in vitro differentiated) macrophages.

Molecular Interaction Atlas (MIA) of This DOT

31 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Anemia	DISTVL0C	Strong	Altered Expression	[1]
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[2]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[2]
Breast cancer	DIS7DPX1	Strong	Biomarker	[3]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[3]
High blood pressure	DISY2OHH	Strong	Biomarker	[4]
Lung cancer	DISCM4YA	Strong	Biomarker	[5]
Lung carcinoma	DISTR26C	Strong	Biomarker	[5]
Metabolic disorder	DIS71G5H	Strong	Biomarker	[6]
Methylmalonic acidemia	DISHY8VB	Strong	Genetic Variation	[7]
Moyamoya disease	DISO62CA	Strong	Biomarker	[8]
Muscular dystrophy	DISJD6P7	Strong	Genetic Variation	[9]
Neoplasm	DISZKGEW	Strong	Biomarker	[5]
Nephropathy	DISXWP4P	Strong	Biomarker	[6]
Non-alcoholic fatty liver disease	DISDG1NL	Strong	Biomarker	[10]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[5]
Obstructive sleep apnea	DIS0SVD1	Strong	Biomarker	[11]
Scott syndrome	DIS4N4IB	Strong	Genetic Variation	[9]
Systemic sclerosis	DISF44L6	Strong	Biomarker	[8]
Transitional cell carcinoma	DISWVVDR	Strong	Biomarker	[12]
Urothelial carcinoma	DISRTNTN	Strong	Biomarker	[12]
Vascular disease	DISVS67S	Strong	Biomarker	[13]
Vitamin B12 deficiency	DIS91UJ1	Strong	Biomarker	[14]
Limb-girdle muscular dystrophy	DISI9Y1Z	moderate	Biomarker	[15]
Optic nerve disorder	DISSOQM8	moderate	Genetic Variation	[16]
Migraine disorder	DISFCQTG	Disputed	Biomarker	[17]
Arrhythmia	DISFF2NI	Limited	Genetic Variation	[18]
Coronary heart disease	DIS5OIP1	Limited	Biomarker	[19]
Generalized anxiety disorder	DISPSQCW	Limited	Biomarker	[20]
Lung squamous cell carcinoma	DISXPIBD	Limited	Biomarker	[21]
Myotonic dystrophy	DISNBEMX	Limited	Genetic Variation	[18]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Monocyte to macrophage differentiation factor (MMD).	[22]

24 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Monocyte to macrophage differentiation factor (MMD).	[23]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Monocyte to macrophage differentiation factor (MMD).	[24]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Monocyte to macrophage differentiation factor (MMD).	[25]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Monocyte to macrophage differentiation factor (MMD).	[26]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Monocyte to macrophage differentiation factor (MMD).	[27]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Monocyte to macrophage differentiation factor (MMD).	[28]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Monocyte to macrophage differentiation factor (MMD).	[29]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Monocyte to macrophage differentiation factor (MMD).	[30]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Monocyte to macrophage differentiation factor (MMD).	[31]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Monocyte to macrophage differentiation factor (MMD).	[32]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Monocyte to macrophage differentiation factor (MMD).	[33]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Monocyte to macrophage differentiation factor (MMD).	[34]
Fenofibrate	DMFKXDY	Approved	Fenofibrate increases the expression of Monocyte to macrophage differentiation factor (MMD).	[35]
Mifepristone	DMGZQEF	Approved	Mifepristone increases the expression of Monocyte to macrophage differentiation factor (MMD).	[36]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Monocyte to macrophage differentiation factor (MMD).	[37]
PD-0325901	DM27D4J	Phase 2	PD-0325901 decreases the expression of Monocyte to macrophage differentiation factor (MMD).	[38]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Monocyte to macrophage differentiation factor (MMD).	[39]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Monocyte to macrophage differentiation factor (MMD).	[40]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Monocyte to macrophage differentiation factor (MMD).	[41]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Monocyte to macrophage differentiation factor (MMD).	[42]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Monocyte to macrophage differentiation factor (MMD).	[43]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Monocyte to macrophage differentiation factor (MMD).	[44]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Monocyte to macrophage differentiation factor (MMD).	[45]
ELLAGIC ACID	DMX8BS5	Investigative	ELLAGIC ACID increases the expression of Monocyte to macrophage differentiation factor (MMD).	[37]

References

• [1] Excessive folic acid intake and relation to adverse health outcome.Biochimie. 2016 Jul;126:71-8. doi: 10.1016/j.biochi.2016.04.010. Epub 2016 Apr 27.
• [2] Development of atherosclerotic-moyamoya syndrome with genetic variant of RNF213 p.R4810K and p.T1727M: A case report.Clin Neurol Neurosurg. 2018 May;168:163-166. doi: 10.1016/j.clineuro.2018.01.034. Epub 2018 Feb 2.
• [3] Genetic polymorphisms of PPAR gamma, arsenic methylation capacity and breast cancer risk in Mexican women.Salud Publica Mex. 2016 Apr;58(2):220-7. doi: 10.21149/spm.v58i2.7791.
• [4] Arsenic methylation capability and hypertension risk in subjects living in arseniasis-hyperendemic areas in southwestern Taiwan.Toxicol Appl Pharmacol. 2007 Jan 15;218(2):135-42. doi: 10.1016/j.taap.2006.10.022. Epub 2006 Oct 28.
• [5] Monocyte to macrophage differentiation-associated (MMD) targeted by miR-140-5p regulates tumor growth in non-small cell lung cancer.Biochem Biophys Res Commun. 2014 Jul 18;450(1):844-50. doi: 10.1016/j.bbrc.2014.06.075. Epub 2014 Jun 24.
• [6] Kidney disease and organ transplantation in methylmalonic acidaemia.Pediatr Transplant. 2019 Jun;23(4):e13407. doi: 10.1111/petr.13407. Epub 2019 Apr 11.
• [7] Outcome of individuals with low-moderate methylmalonic aciduria detected through a neonatal screening program.J Pediatr. 1999 Jun;134(6):675-80. doi: 10.1016/s0022-3476(99)70280-5.
• [8] Systemic sclerosis associated with moyamoya syndrome: A case report and literature review.Immunobiology. 2020 Mar;225(2):151882. doi: 10.1016/j.imbio.2019.11.017. Epub 2019 Nov 28.
• [9] Physiological roles and diseases of Tmem16/Anoctamin proteins: are they all chloride channels?.Acta Pharmacol Sin. 2011 Jun;32(6):685-92. doi: 10.1038/aps.2011.48.
• [10] Impact of prenatal arsenic exposure on chronic adult diseases.Syst Biol Reprod Med. 2018 Dec;64(6):469-483. doi: 10.1080/19396368.2018.1480076. Epub 2018 Jun 6.
• [11] Use of CAD-CAM technology to improve orthognathic surgeryoutcomes in patients with severe obstructive sleep apnoea syndrome.J Craniomaxillofac Surg. 2019 Sep;47(9):1331-1337. doi: 10.1016/j.jcms.2019.06.010. Epub 2019 Jun 25.
• [12] Trivalent arsenicals induce lipid peroxidation, protein carbonylation, and oxidative DNA damage in human urothelial cells.Mutat Res. 2007 Feb 3;615(1-2):75-86. doi: 10.1016/j.mrfmmm.2006.10.003. Epub 2006 Nov 28.
• [13] Mutations in smooth muscle alpha-actin (ACTA2) cause coronary artery disease, stroke, and Moyamoya disease, along with thoracic aortic disease.Am J Hum Genet. 2009 May;84(5):617-27. doi: 10.1016/j.ajhg.2009.04.007. Epub 2009 Apr 30.
• [14] Cobalamin deficiency presenting with thrombotic microangiopathy (TMA) features: A systematic review.Transfus Apher Sci. 2018 Feb;57(1):102-106. doi: 10.1016/j.transci.2018.01.003. Epub 2018 Jan 11.
• [15] Comparing clinical data and muscle imaging of DYSF and ANO5 related muscular dystrophies.Neuromuscul Disord. 2014 Dec;24(12):1097-102. doi: 10.1016/j.nmd.2014.07.004. Epub 2014 Aug 1.
• [16] Optic neuropathy in classical methylmalonic acidemia.Ophthalmic Genet. 2019 Aug;40(4):313-322. doi: 10.1080/13816810.2019.1634740. Epub 2019 Jul 4.
• [17] Migraine day frequency in migraine prevention: longitudinal modelling approaches.BMC Med Res Methodol. 2019 Jan 23;19(1):20. doi: 10.1186/s12874-019-0664-5.
• [18] Myocardial fibrosis by late gadolinium enhancement cardiovascular magnetic resonance in myotonic muscular dystrophy type 1: highly prevalent but not associated with surface conduction abnormality.J Cardiovasc Magn Reson. 2019 May 2;21(1):26. doi: 10.1186/s12968-019-0535-6.
• [19] Genetic polymorphisms involved in folate metabolism and concentrations of methylmalonic acid and folate on plasma homocysteine and risk of coronary artery disease.J Thromb Thrombolysis. 2010 Jan;29(1):32-40. doi: 10.1007/s11239-009-0321-7. Epub 2009 Mar 13.
• [20] Evaluating quality of life in epilepsy: The role of screening for adverse drug effects, depression, and anxiety.Epilepsy Behav. 2017 Oct;75:18-24. doi: 10.1016/j.yebeh.2017.07.016. Epub 2017 Aug 15.
• [21] Main histologic types of non-small-cell lung cancer differ in expression of prognosis-related genes.Clin Lung Cancer. 2013 Nov;14(6):666-673.e2. doi: 10.1016/j.cllc.2013.04.010. Epub 2013 Jul 17.
• [22] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [23] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [24] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [25] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [26] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [27] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [28] Persistent and non-persistent changes in gene expression result from long-term estrogen exposure of MCF-7 breast cancer cells. J Steroid Biochem Mol Biol. 2011 Feb;123(3-5):140-50.
• [29] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [30] Oxidative stress modulates theophylline effects on steroid responsiveness. Biochem Biophys Res Commun. 2008 Dec 19;377(3):797-802.
• [31] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [32] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [33] Unique transcriptome, pathways, and networks in the human endometrial fibroblast response to progesterone in endometriosis. Biol Reprod. 2011 Apr;84(4):801-15.
• [34] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [35] Transcriptomic analysis of untreated and drug-treated differentiated HepaRG cells over a 2-week period. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):27-35.
• [36] Mifepristone induced progesterone withdrawal reveals novel regulatory pathways in human endometrium. Mol Hum Reprod. 2007 Sep;13(9):641-54.
• [37] Interactive gene expression pattern in prostate cancer cells exposed to phenolic antioxidants. Life Sci. 2002 Mar 1;70(15):1821-39.
• [38] PRC2 loss amplifies Ras-driven transcription and confers sensitivity to BRD4-based therapies. Nature. 2014 Oct 9;514(7521):247-51.
• [39] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [40] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [41] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [42] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [43] Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.
• [44] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [45] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.