Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTCO26FV)

DOT Name Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1)
Synonyms HMG-CoA synthase; EC 2.3.3.10; 3-hydroxy-3-methylglutaryl coenzyme A synthase
Gene Name HMGCS1
UniProt ID
HMCS1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2P8U
EC Number
2.3.3.10
Pfam ID
PF08540 ; PF01154
Sequence
MPGSLPLNAEACWPKDVGIVALEIYFPSQYVDQAELEKYDGVDAGKYTIGLGQAKMGFCT
DREDINSLCMTVVQNLMERNNLSYDCIGRLEVGTETIIDKSKSVKTNLMQLFEESGNTDI
EGIDTTNACYGGTAAVFNAVNWIESSSWDGRYALVVAGDIAVYATGNARPTGGVGAVALL
IGPNAPLIFERGLRGTHMQHAYDFYKPDMLSEYPIVDGKLSIQCYLSALDRCYSVYCKKI
HAQWQKEGNDKDFTLNDFGFMIFHSPYCKLVQKSLARMLLNDFLNDQNRDKNSIYSGLEA
FGDVKLEDTYFDRDVEKAFMKASSELFSQKTKASLLVSNQNGNMYTSSVYGSLASVLAQY
SPQQLAGKRIGVFSYGSGLAATLYSLKVTQDATPGSALDKITASLCDLKSRLDSRTGVAP
DVFAENMKLREDTHHLVNYIPQGSIDSLFEGTWYLVRVDEKHRRTYARRPTPNDDTLDEG
VGLVHSNIATEHIPSPAKKVPRLPATAAEPEAAVISNGEH
Function Catalyzes the condensation of acetyl-CoA with acetoacetyl-CoA to form HMG-CoA, which is converted by HMG-CoA reductase (HMGCR) into mevalonate, a precursor for cholesterol synthesis.
KEGG Pathway
Valine, leucine and isoleucine degradation (hsa00280 )
Butanoate metabolism (hsa00650 )
Terpenoid backbone biosynthesis (hsa00900 )
Metabolic pathways (hsa01100 )
PPAR sig.ling pathway (hsa03320 )
Reactome Pathway
PPARA activates gene expression (R-HSA-1989781 )
Activation of gene expression by SREBF (SREBP) (R-HSA-2426168 )
Cholesterol biosynthesis (R-HSA-191273 )
BioCyc Pathway
MetaCyc:ENSG00000112972-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 1 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Topotecan DMP6G8T Approved Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1) affects the response to substance of Topotecan. [55]
------------------------------------------------------------------------------------
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [1]
Fulvestrant DM0YZC6 Approved Fulvestrant increases the methylation of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [17]
Coumarin DM0N8ZM Investigative Coumarin increases the phosphorylation of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [46]
------------------------------------------------------------------------------------
68 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [2]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [3]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [4]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate affects the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [5]
Cisplatin DMRHGI9 Approved Cisplatin affects the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [6]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [7]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [8]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [9]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [10]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [11]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [12]
Vorinostat DMWMPD4 Approved Vorinostat decreases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [13]
Testosterone DM7HUNW Approved Testosterone increases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [12]
Decitabine DMQL8XJ Approved Decitabine decreases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [14]
Zoledronate DMIXC7G Approved Zoledronate increases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [15]
Progesterone DMUY35B Approved Progesterone increases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [16]
Dexamethasone DMMWZET Approved Dexamethasone decreases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [18]
Cannabidiol DM0659E Approved Cannabidiol decreases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [19]
Isotretinoin DM4QTBN Approved Isotretinoin decreases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [20]
Troglitazone DM3VFPD Approved Troglitazone decreases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [21]
Diethylstilbestrol DMN3UXQ Approved Diethylstilbestrol decreases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [22]
Clozapine DMFC71L Approved Clozapine increases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [23]
Obeticholic acid DM3Q1SM Approved Obeticholic acid decreases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [24]
Cyclophosphamide DM4O2Z7 Approved Cyclophosphamide increases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [25]
Lucanthone DMZLBUO Approved Lucanthone increases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [26]
Pioglitazone DMKJ485 Approved Pioglitazone increases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [27]
Haloperidol DM96SE0 Approved Haloperidol increases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [23]
Lindane DMB8CNL Approved Lindane decreases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [25]
Prednisolone DMQ8FR2 Approved Prednisolone increases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [25]
Fluoxetine DM3PD2C Approved Fluoxetine increases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [28]
Chenodiol DMQ8JIK Approved Chenodiol affects the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [29]
Olanzapine DMPFN6Y Approved Olanzapine increases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [30]
Crizotinib DM4F29C Approved Crizotinib increases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [31]
Imipramine DM2NUH3 Approved Imipramine increases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [28]
Clomipramine DMINRKW Approved Clomipramine increases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [28]
Citalopram DM2G9AE Approved Citalopram increases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [28]
Bupropion DM5PCS7 Approved Bupropion increases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [28]
Racecadotril DMFOTZ7 Approved Racecadotril increases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [32]
Ziprasidone DMM58JY Approved Ziprasidone increases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [30]
Mirtazapine DML53ZJ Approved Mirtazapine increases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [28]
Dihydrotestosterone DM3S8XC Phase 4 Dihydrotestosterone increases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [33]
Isoflavone DM7U58J Phase 4 Isoflavone increases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [34]
SNDX-275 DMH7W9X Phase 3 SNDX-275 decreases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [35]
Resveratrol DM3RWXL Phase 3 Resveratrol increases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [36]
Tamibarotene DM3G74J Phase 3 Tamibarotene affects the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [3]
Epigallocatechin gallate DMCGWBJ Phase 3 Epigallocatechin gallate increases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [37]
Chlorpromazine DMBGZI3 Phase 3 Trial Chlorpromazine increases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [30]
GSK2110183 DMZHB37 Phase 2 GSK2110183 increases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [38]
phorbol 12-myristate 13-acetate DMJWD62 Phase 2 phorbol 12-myristate 13-acetate increases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [27]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [25]
GSK618334 DMJPXZ4 Phase 1 GSK618334 increases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [25]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [31]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 increases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [39]
THAPSIGARGIN DMDMQIE Preclinical THAPSIGARGIN decreases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [40]
Celastrol DMWQIJX Preclinical Celastrol increases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [41]
UNC0379 DMD1E4J Preclinical UNC0379 increases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [42]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [43]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [44]
Milchsaure DM462BT Investigative Milchsaure increases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [45]
chloropicrin DMSGBQA Investigative chloropicrin increases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [47]
methyl p-hydroxybenzoate DMO58UW Investigative methyl p-hydroxybenzoate increases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [48]
Phencyclidine DMQBEYX Investigative Phencyclidine decreases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [49]
[3H]methyltrienolone DMTSGOW Investigative [3H]methyltrienolone increases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [50]
PP-242 DM2348V Investigative PP-242 decreases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [51]
OXYBENZONE DMMZYX6 Investigative OXYBENZONE increases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [52]
BETULIN DMGQRON Investigative BETULIN decreases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [53]
Ganoderic acid A DM42EVG Investigative Ganoderic acid A decreases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [54]
PF-429242 DMB0OZ3 Investigative PF-429242 decreases the expression of Hydroxymethylglutaryl-CoA synthase, cytoplasmic (HMGCS1). [53]
------------------------------------------------------------------------------------
⏷ Show the Full List of 68 Drug(s)

References

1 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
3 Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
4 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
5 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6 Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
7 Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
8 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
9 Hypoxia-inducible factor-1 (HIF-1) pathway activation by quercetin in human lens epithelial cells. Exp Eye Res. 2009 Dec;89(6):995-1002. doi: 10.1016/j.exer.2009.08.011. Epub 2009 Sep 1.
10 Gene expression profile induced by arsenic trioxide in chronic lymphocytic leukemia cells reveals a central role for heme oxygenase-1 in apoptosis and regulation of matrix metalloproteinase-9. Oncotarget. 2016 Dec 13;7(50):83359-83377.
11 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
12 Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
13 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
14 The DNA methyltransferase inhibitors azacitidine, decitabine and zebularine exert differential effects on cancer gene expression in acute myeloid leukemia cells. Leukemia. 2009 Jun;23(6):1019-28.
15 Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
16 Coordinate up-regulation of TMEM97 and cholesterol biosynthesis genes in normal ovarian surface epithelial cells treated with progesterone: implications for pathogenesis of ovarian cancer. BMC Cancer. 2007 Dec 11;7:223.
17 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
18 Gene expression profile of human lymphoid CEM cells sensitive and resistant to glucocorticoid-evoked apoptosis. Genomics. 2003 Jun;81(6):543-55.
19 Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
20 Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
21 Transcriptomic analysis of untreated and drug-treated differentiated HepaRG cells over a 2-week period. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):27-35.
22 Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
23 Antipsychotic drugs activate SREBP-regulated expression of lipid biosynthetic genes in cultured human glioma cells: a novel mechanism of action? Pharmacogenomics J. 2005;5(5):298-304.
24 Pharmacotoxicology of clinically-relevant concentrations of obeticholic acid in an organotypic human hepatocyte system. Toxicol In Vitro. 2017 Mar;39:93-103.
25 Transcriptome-based functional classifiers for direct immunotoxicity. Arch Toxicol. 2014 Mar;88(3):673-89.
26 Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
27 PPAR gamma ligands, troglitazone and pioglitazone, up-regulate expression of HMG-CoA synthase and HMG-CoA reductase gene in THP-1 macrophages. FEBS Lett. 2002 Jun 5;520(1-3):177-81.
28 Antidepressant drugs activate SREBP and up-regulate cholesterol and fatty acid biosynthesis in human glial cells. Neurosci Lett. 2006 Mar 13;395(3):185-90. doi: 10.1016/j.neulet.2005.10.096. Epub 2005 Dec 1.
29 System analysis of cross-talk between nuclear receptors reveals an opposite regulation of the cell cycle by LXR and FXR in human HepaRG liver cells. PLoS One. 2019 Aug 22;14(8):e0220894. doi: 10.1371/journal.pone.0220894. eCollection 2019.
30 Drug-induced activation of SREBP-controlled lipogenic gene expression in CNS-related cell lines: marked differences between various antipsychotic drugs. BMC Neurosci. 2006 Oct 20;7:69.
31 Multi-parameter in vitro toxicity testing of crizotinib, sunitinib, erlotinib, and nilotinib in human cardiomyocytes. Toxicol Appl Pharmacol. 2013 Oct 1;272(1):245-55.
32 Successful validation of genomic biomarkers for human immunotoxicity in Jurkat T cells in vitro. J Appl Toxicol. 2015 Jul;35(7):831-41.
33 LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
34 Soy isoflavones exert differential effects on androgen responsive genes in LNCaP human prostate cancer cells. J Nutr. 2007 Apr;137(4):964-72.
35 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
36 Resveratrol increases the expression and activity of the low density lipoprotein receptor in hepatocytes by the proteolytic activation of the sterol regulatory element-binding proteins. Atherosclerosis. 2012 Feb;220(2):369-74. doi: 10.1016/j.atherosclerosis.2011.11.006. Epub 2011 Nov 16.
37 Integrated transcriptomic and metabolomic analyses to characterize the anti-cancer effects of (-)-epigallocatechin-3-gallate in human colon cancer cells. Toxicol Appl Pharmacol. 2020 Aug 15;401:115100. doi: 10.1016/j.taap.2020.115100. Epub 2020 Jun 6.
38 Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
39 Caffeine programs hepatic SIRT1-related cholesterol synthesis and hypercholesterolemia via A2AR/cAMP/PKA pathway in adult male offspring rats. Toxicology. 2019 Apr 15;418:11-21.
40 Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
41 Gene expression signature-based chemical genomic prediction identifies a novel class of HSP90 pathway modulators. Cancer Cell. 2006 Oct;10(4):321-30.
42 Epigenetic siRNA and chemical screens identify SETD8 inhibition as a therapeutic strategy for p53 activation in high-risk neuroblastoma. Cancer Cell. 2017 Jan 9;31(1):50-63.
43 Bisphenol-A exposure and gene expression in human luteinized membrana granulosa cells in vitro. Hum Reprod. 2017 Feb;32(2):409-417. doi: 10.1093/humrep/dew316. Epub 2016 Dec 15.
44 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
45 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
46 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
47 Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
48 Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
49 Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.
50 Evaluation of an in vitro model of androgen ablation and identification of the androgen responsive proteome in LNCaP cells. Proteomics. 2007 Jan;7(1):47-63.
51 Marine biogenics in sea spray aerosols interact with the mTOR signaling pathway. Sci Rep. 2019 Jan 24;9(1):675.
52 Benzophenone-3 and benzophenone-8 exhibit obesogenic activity via peroxisome proliferator-activated receptor pathway. Toxicol In Vitro. 2020 Sep;67:104886. doi: 10.1016/j.tiv.2020.104886. Epub 2020 May 11.
53 Fatostatin inhibits cancer cell proliferation by affecting mitotic microtubule spindle assembly and cell division. J Biol Chem. 2016 Aug 12;291(33):17001-8.
54 Ganoderic Acid A improves high fat diet-induced obesity, lipid accumulation and insulin sensitivity through regulating SREBP pathway. Chem Biol Interact. 2018 Jun 25;290:77-87.
55 Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.