Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTDUC9ME)

• DOT Name: Cytoskeleton-associated protein 4 (CKAP4)
• Synonyms: 63-kDa cytoskeleton-linking membrane protein; Climp-63; p63
• Gene Name: CKAP4
• Related Disease:
  ADULT syndrome
  B-cell neoplasm
  Cleft lip/palate
  Ovarian cancer
  Urinary bladder cancer
  Anaplastic large cell lymphoma
  Bladder cancer
  Bone osteosarcoma
  Breast cancer
  Breast carcinoma
  Cervical cancer
  Cervical carcinoma
  Colon cancer
  Colorectal carcinoma
  Congenital deformities of limbs
  Ductal carcinoma
  Head-neck squamous cell carcinoma
  Hepatocellular carcinoma
  Limb-mammary syndrome
  Matthew-Wood syndrome
  Metastatic malignant neoplasm
  Neuroendocrine neoplasm
  Non-small-cell lung cancer
  Osteosarcoma
  Ovarian neoplasm
  Transitional cell carcinoma
  Urinary bladder neoplasm
  Asthma
  Cleft palate
  Isolated cleft palate
  Lung adenocarcinoma
  Melanoma
  Thyroid gland papillary carcinoma
  Triple negative breast cancer
  Rapp-Hodgkin syndrome
  Breast neoplasm
  Carcinoma
  Ductal breast carcinoma in situ
  Ectodermal dysplasia
  Small-cell lung cancer
  Split hand-foot malformation
• UniProt ID: CKAP4_HUMAN
• Sequence:
  MPSAKQRGSKGGHGAASPSEKGAHPSGGADDVAKKPPPAPQQPPPPPAPHPQQHPQQHPQ
  NQAHGKGGHRGGGGGGGKSSSSSSASAAAAAAAASSSASCSRRLGRALNFLFYLALVAAA
  AFSGWCVHHVLEEVQQVRRSHQDFSRQREELGQGLQGVEQKVQSLQATFGTFESILRSSQ
  HKQDLTEKAVKQGESEVSRISEVLQKLQNEILKDLSDGIHVVKDARERDFTSLENTVEER
  LTELTKSINDNIAIFTEVQKRSQKEINDMKAKVASLEESEGNKQDLKALKEAVKEIQTSA
  KSREWDMEALRSTLQTMESDIYTEVRELVSLKQEQQAFKEAADTERLALQALTEKLLRSE
  ESVSRLPEEIRRLEEELRQLKSDSHGPKEDGGFRHSEAFEALQQKSQGLDSRLQHVEDGV
  LSMQVASARQTESLESLLSKSQEHEQRLAALQGRLEGLGSSEADQDGLASTVRSLGETQL
  VLYGDVEELKRSVGELPSTVESLQKVQEQVHTLLSQDQAQAARLPPQDFLDRLSSLDNLK
  ASVSQVEADLKMLRTAVDSLVAYSVKIETNENNLESAKGLLDDLRNDLDRLFVKVEKIHE
  KV
• Function: Mediates the anchoring of the endoplasmic reticulum to microtubules; High-affinity epithelial cell surface receptor for the FZD8-related low molecular weight sialoglycopeptide APF/antiproliferative factor. Mediates the APF antiproliferative signaling within cells.
• KEGG Pathway: Protein processing in endoplasmic reticulum (hsa04141)
• Reactome Pathway:
  Surfactant metabolism (R-HSA-5683826)
  Neutrophil degranulation (R-HSA-6798695)
  Post-translational protein phosphorylation (R-HSA-8957275)
  RND3 GTPase cycle (R-HSA-9696264)
  RND2 GTPase cycle (R-HSA-9696270)
  Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) (R-HSA-381426)

Molecular Interaction Atlas (MIA) of This DOT

41 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
ADULT syndrome	DISIXF16	Definitive	Genetic Variation	[1]
B-cell neoplasm	DISVY326	Definitive	Altered Expression	[2]
Cleft lip/palate	DIS14IG3	Definitive	Genetic Variation	[3]
Ovarian cancer	DISZJHAP	Definitive	Altered Expression	[4]
Urinary bladder cancer	DISDV4T7	Definitive	Biomarker	[5]
Anaplastic large cell lymphoma	DISP4D1R	Strong	Genetic Variation	[6]
Bladder cancer	DISUHNM0	Strong	Biomarker	[5]
Bone osteosarcoma	DIST1004	Strong	Altered Expression	[7]
Breast cancer	DIS7DPX1	Strong	Biomarker	[8]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[8]
Cervical cancer	DISFSHPF	Strong	Biomarker	[9]
Cervical carcinoma	DIST4S00	Strong	Biomarker	[9]
Colon cancer	DISVC52G	Strong	Biomarker	[10]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[11]
Congenital deformities of limbs	DISP4N1Q	Strong	Genetic Variation	[12]
Ductal carcinoma	DIS15EA5	Strong	Biomarker	[13]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Biomarker	[14]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[15]
Limb-mammary syndrome	DIS7H4FP	Strong	Genetic Variation	[1]
Matthew-Wood syndrome	DISA7HR7	Strong	Biomarker	[16]
Metastatic malignant neoplasm	DIS86UK6	Strong	Biomarker	[17]
Neuroendocrine neoplasm	DISNPLOO	Strong	Biomarker	[18]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[19]
Osteosarcoma	DISLQ7E2	Strong	Altered Expression	[7]
Ovarian neoplasm	DISEAFTY	Strong	Genetic Variation	[20]
Transitional cell carcinoma	DISWVVDR	Strong	Altered Expression	[21]
Urinary bladder neoplasm	DIS7HACE	Strong	Biomarker	[5]
Asthma	DISW9QNS	moderate	Altered Expression	[22]
Cleft palate	DIS6G5TF	moderate	Altered Expression	[23]
Isolated cleft palate	DISV80CD	moderate	Altered Expression	[23]
Lung adenocarcinoma	DISD51WR	moderate	Altered Expression	[24]
Melanoma	DIS1RRCY	moderate	Altered Expression	[25]
Thyroid gland papillary carcinoma	DIS48YMM	moderate	Biomarker	[26]
Triple negative breast cancer	DISAMG6N	moderate	Biomarker	[27]
Rapp-Hodgkin syndrome	DISCNGW9	Disputed	Genetic Variation	[28]
Breast neoplasm	DISNGJLM	Limited	Altered Expression	[29]
Carcinoma	DISH9F1N	Limited	Genetic Variation	[30]
Ductal breast carcinoma in situ	DISLCJY7	Limited	Biomarker	[31]
Ectodermal dysplasia	DISLRS4M	Limited	Genetic Variation	[32]
Small-cell lung cancer	DISK3LZD	Limited	Altered Expression	[33]
Split hand-foot malformation	DIS8PKGD	Limited	Genetic Variation	[34]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Methotrexate	DM2TEOL	Approved	Cytoskeleton-associated protein 4 (CKAP4) affects the response to substance of Methotrexate.	[54]

16 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of Cytoskeleton-associated protein 4 (CKAP4).	[35]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Cytoskeleton-associated protein 4 (CKAP4).	[36]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Cytoskeleton-associated protein 4 (CKAP4).	[37]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Cytoskeleton-associated protein 4 (CKAP4).	[38]
Doxorubicin	DMVP5YE	Approved	Doxorubicin affects the expression of Cytoskeleton-associated protein 4 (CKAP4).	[39]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Cytoskeleton-associated protein 4 (CKAP4).	[40]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Cytoskeleton-associated protein 4 (CKAP4).	[42]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Cytoskeleton-associated protein 4 (CKAP4).	[43]
Clozapine	DMFC71L	Approved	Clozapine increases the expression of Cytoskeleton-associated protein 4 (CKAP4).	[44]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Cytoskeleton-associated protein 4 (CKAP4).	[45]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate increases the expression of Cytoskeleton-associated protein 4 (CKAP4).	[46]
APR-246	DMNFADH	Phase 2	APR-246 affects the expression of Cytoskeleton-associated protein 4 (CKAP4).	[47]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Cytoskeleton-associated protein 4 (CKAP4).	[49]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Cytoskeleton-associated protein 4 (CKAP4).	[50]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of Cytoskeleton-associated protein 4 (CKAP4).	[52]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Cytoskeleton-associated protein 4 (CKAP4).	[53]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Cytoskeleton-associated protein 4 (CKAP4).	[41]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Cytoskeleton-associated protein 4 (CKAP4).	[48]
Coumarin	DM0N8ZM	Investigative	Coumarin decreases the phosphorylation of Cytoskeleton-associated protein 4 (CKAP4).	[51]

References

• [1] Ectodermal dysplasias: the p63 tail.G Ital Dermatol Venereol. 2013 Feb;148(1):53-8.
• [2] Comparative pathologic analysis of mediastinal B-cell lymphomas: selective expression of p63 but no GATA3 optimally differentiates primary mediastinal large B-cell lymphoma from classic Hodgkin lymphoma.Diagn Pathol. 2019 Dec 12;14(1):133. doi: 10.1186/s13000-019-0918-x.
• [3] Single-cell RNA-seq identifies a reversible mesodermal activation in abnormally specified epithelia of p63 EEC syndrome.Proc Natl Acad Sci U S A. 2019 Aug 27;116(35):17361-17370. doi: 10.1073/pnas.1908180116. Epub 2019 Aug 14.
• [4] An integrative genomic approach identifies p73 and p63 as activators of miR-200 microRNA family transcription.Nucleic Acids Res. 2012 Jan;40(2):499-510. doi: 10.1093/nar/gkr731. Epub 2011 Sep 14.
• [5] Decreased c-Myc mRNA Stability via the MicroRNA 141-3p/AUF1 Axis Is Crucial for p63 Inhibition of Cyclin D1 Gene Transcription and Bladder Cancer Cell Tumorigenicity.Mol Cell Biol. 2018 Oct 15;38(21):e00273-18. doi: 10.1128/MCB.00273-18. Print 2018 Nov 1.
• [6] ALCL by any other name: the many facets of anaplastic large cell lymphoma.Pathology. 2020 Jan;52(1):100-110. doi: 10.1016/j.pathol.2019.09.007. Epub 2019 Nov 6.
• [7] Np63 enhances the oncogenic phenotype of osteosarcoma cells by inducing the expression of GLI2.BMC Cancer. 2014 Aug 1;14:559. doi: 10.1186/1471-2407-14-559.
• [8] Diagnostic utility of CD205 in breast cancer: Simultaneous detection of myoepithelial cells and dendritic cells in breast tissue by CD205.Histol Histopathol. 2020 May;35(5):481-488. doi: 10.14670/HH-18-164. Epub 2019 Sep 16.
• [9] Np63 to TAp63 expression ratio as a potential molecular marker for cervical cancer prognosis.PLoS One. 2019 Apr 11;14(4):e0214867. doi: 10.1371/journal.pone.0214867. eCollection 2019.
• [10] Synergistic activation of the NEU4 promoter by p73 and AP2 in colon cancer cells.Sci Rep. 2019 Jan 30;9(1):950. doi: 10.1038/s41598-018-37521-7.
• [11] Primate-specific miR-944 activates p53-dependent tumor suppression in human colorectal cancers.Cancer Lett. 2019 Jan;440-441:168-179. doi: 10.1016/j.canlet.2018.10.029. Epub 2018 Oct 27.
• [12] Spectrum of p63 mutations in a selected patient cohort affected with ankyloblepharon-ectodermal defects-cleft lip/palate syndrome (AEC).Am J Med Genet A. 2009 Sep;149A(9):1948-51. doi: 10.1002/ajmg.a.32793.
• [13] Immunocytochemical analysis of p63 and 34E12 in fine needle aspiration cytology specimens for breast lesions: a potentially useful discriminatory marker between intraductal papilloma and ductal carcinoma insitu.Cytopathology. 2016 Apr;27(2):108-14. doi: 10.1111/cyt.12244. Epub 2015 Mar 25.
• [14] ACTL6A Is Co-Amplified with p63 in Squamous Cell Carcinoma to Drive YAP Activation, Regenerative Proliferation, and Poor Prognosis.Cancer Cell. 2017 Jan 9;31(1):35-49. doi: 10.1016/j.ccell.2016.12.001. Epub 2016 Dec 29.
• [15] Serum cytoskeleton-associated protein 4 as a biomarker for the diagnosis of hepatocellular carcinoma.Onco Targets Ther. 2018 Dec 31;12:359-364. doi: 10.2147/OTT.S189425. eCollection 2019.
• [16] CKAP4, a DKK1 Receptor, Is a Biomarker in Exosomes Derived from Pancreatic Cancer and a Molecular Target for Therapy.Clin Cancer Res. 2019 Mar 15;25(6):1936-1947. doi: 10.1158/1078-0432.CCR-18-2124. Epub 2019 Jan 4.
• [17] A double dealing tale of p63: an oncogene or a tumor suppressor.Cell Mol Life Sci. 2018 Mar;75(6):965-973. doi: 10.1007/s00018-017-2666-y. Epub 2017 Oct 3.
• [18] Well-differentiated neuroendocrine tumors in skin: Terminology and diagnostic utility of cytokeratin 5/6 and p63.J Cutan Pathol. 2017 Jun;44(6):557-562. doi: 10.1111/cup.12952.
• [19] Agreement of CK5/6, p40, and p63 immunoreactivity in non-small cell lung cancer.Pathology. 2019 Apr;51(3):240-245. doi: 10.1016/j.pathol.2018.11.009. Epub 2019 Feb 21.
• [20] Polymorphisms in the p63 and p73 genes are associated with ovarian cancer risk and clinicopathological variables.J Exp Clin Cancer Res. 2012 Oct 24;31(1):89. doi: 10.1186/1756-9966-31-89.
• [21] Aberrant -catenin expression in urothelial carcinomas in blackfoot disease-endemic areas.Kaohsiung J Med Sci. 2017 Jan;33(1):11-16. doi: 10.1016/j.kjms.2016.10.006. Epub 2016 Nov 4.
• [22] Disruption of -catenin/CBP signaling inhibits human airway epithelial-mesenchymal transition and repair.Int J Biochem Cell Biol. 2015 Nov;68:59-69. doi: 10.1016/j.biocel.2015.08.014. Epub 2015 Aug 24.
• [23] Periderm: Life-cycle and function during orofacial and epidermal development.Semin Cell Dev Biol. 2019 Jul;91:75-83. doi: 10.1016/j.semcdb.2017.08.021. Epub 2017 Aug 10.
• [24] ALK-rearranged squamous cell lung carcinoma responding to crizotinib: A missing link in the field of non-small cell lung cancer?.Lung Cancer. 2016 Jan;91:67-9. doi: 10.1016/j.lungcan.2015.11.010. Epub 2015 Nov 10.
• [25] Discovering biological connections between experimental conditions based on common patterns of differential gene expression.BMC Bioinformatics. 2011 Sep 27;12:381. doi: 10.1186/1471-2105-12-381.
• [26] p63 inhibits CD44(+)/CD24(-) cell proliferation and chemoresistance in papillary thyroid carcinoma cells.Exp Ther Med. 2017 Nov;14(5):4693-4696. doi: 10.3892/etm.2017.5137. Epub 2017 Sep 19.
• [27] SHARP1 suppresses breast cancer metastasis by promoting degradation of hypoxia-inducible factors.Nature. 2012 Jul 19;487(7407):380-4. doi: 10.1038/nature11207.
• [28] Rapp-Hodgkin syndrome and SHFM1 patients: delineating the p63-Dlx5/Dlx6 pathway.Gene. 2012 Apr 15;497(2):292-7. doi: 10.1016/j.gene.2012.01.088. Epub 2012 Feb 9.
• [29] Setdb1, a novel interactor of Np63, is involved in breast tumorigenesis.Oncotarget. 2016 May 17;7(20):28836-48. doi: 10.18632/oncotarget.7089.
• [30] RETRACTED ARTICLE: Cervical adenosquamous carcinoma: detailed analysis of morphology, immunohistochemical profile, and clinical outcomes in 59 cases.Mod Pathol. 2019 Feb;32(2):269-279. doi: 10.1038/s41379-018-0123-6. Epub 2018 Sep 26.
• [31] P40 Immunostain Does Not Outperform p63 as a Myoepithelial Cell Marker in the Daily Practice of Breast Pathology.Appl Immunohistochem Mol Morphol. 2018 Sep;26(8):599-604. doi: 10.1097/PAI.0000000000000507.
• [32] DLX5, FGF8 and the Pin1 isomerase control Np63 protein stability during limb development: a regulatory loop at the basis of the SHFM and EEC congenital malformations.Hum Mol Genet. 2014 Jul 15;23(14):3830-42. doi: 10.1093/hmg/ddu096. Epub 2014 Feb 25.
• [33] Clinical relevance and accuracy of p63 and TTF-1 for better approach of small cell lung carcinoma versus poorly differentiated nonkeratinizing squamous cell carcinoma.Rom J Morphol Embryol. 2019;60(1):139-143.
• [34] Mutant p63 Affects Epidermal Cell Identity through Rewiring the Enhancer Landscape.Cell Rep. 2018 Dec 18;25(12):3490-3503.e4. doi: 10.1016/j.celrep.2018.11.039.
• [35] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [36] Cyclosporine A--induced oxidative stress in human renal mesangial cells: a role for ERK 1/2 MAPK signaling. Toxicol Sci. 2012 Mar;126(1):101-13.
• [37] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [38] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [39] Expression Profiling of Human Pluripotent Stem Cell-Derived Cardiomyocytes Exposed to Doxorubicin-Integration and Visualization of Multi-Omics Data. Toxicol Sci. 2018 May 1;163(1):182-195. doi: 10.1093/toxsci/kfy012.
• [40] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [41] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [42] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [43] Gene expression profile changes in NB4 cells induced by arsenic trioxide. Acta Pharmacol Sin. 2003 Jul;24(7):646-50.
• [44] Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
• [45] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [46] Comparative proteomics reveals concordant and discordant biochemical effects of caffeine versus epigallocatechin-3-gallate in human endothelial cells. Toxicol Appl Pharmacol. 2019 Sep 1;378:114621. doi: 10.1016/j.taap.2019.114621. Epub 2019 Jun 10.
• [47] Mutant p53 reactivation by PRIMA-1MET induces multiple signaling pathways converging on apoptosis. Oncogene. 2010 Mar 4;29(9):1329-38. doi: 10.1038/onc.2009.425. Epub 2009 Nov 30.
• [48] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [49] Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.
• [50] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [51] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [52] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [53] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [54] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.