Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTE2O72Q)

DOT Name Glutathione peroxidase 1 (GPX1)
Synonyms GPx-1; GSHPx-1; EC 1.11.1.9; Cellular glutathione peroxidase; Phospholipid-hydroperoxide glutathione peroxidase GPX1; EC 1.11.1.12
Gene Name GPX1
UniProt ID
GPX1_HUMAN
PDB ID
2F8A
EC Number
1.11.1.12; 1.11.1.9
Pfam ID
PF00255
Sequence
MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLUGTTVRDYTQMN
ELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGA
GAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYS
RRFQTIDIEPDIEALLSQGPSCA
Function
Catalyzes the reduction of hydroperoxides in a glutathione-dependent manner thus regulating cellular redox homeostasis. Can reduce small soluble hydroperoxides such as H2O2, cumene hydroperoxide and tert-butyl hydroperoxide, as well as several fatty acid-derived hydroperoxides. In platelets catalyzes the reduction of 12-hydroperoxyeicosatetraenoic acid, the primary product of the arachidonate 12-lipoxygenase pathway.
Tissue Specificity Expressed in platelets (at protein level).
KEGG Pathway
Glutathione metabolism (hsa00480 )
Metabolic pathways (hsa01100 )
Thyroid hormone synthesis (hsa04918 )
Amyotrophic lateral sclerosis (hsa05014 )
Huntington disease (hsa05016 )
Pathways of neurodegeneration - multiple diseases (hsa05022 )
Reactome Pathway
Synthesis of 12-eicosatetraenoic acid derivatives (R-HSA-2142712 )
Synthesis of 15-eicosatetraenoic acid derivatives (R-HSA-2142770 )
Detoxification of Reactive Oxygen Species (R-HSA-3299685 )
Synthesis of 5-eicosatetraenoic acids (R-HSA-2142688 )
BioCyc Pathway
MetaCyc:HS00019-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 4 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Menadione DMSJDTY Approved Glutathione peroxidase 1 (GPX1) decreases the response to substance of Menadione. [60]
Diethylstilbestrol DMN3UXQ Approved Glutathione peroxidase 1 (GPX1) increases the Congenital, familial and genetic disorders ADR of Diethylstilbestrol. [61]
Cyclophosphamide DM4O2Z7 Approved Glutathione peroxidase 1 (GPX1) increases the Pulmonary toxicity ADR of Cyclophosphamide. [61]
Cephaloridine DM4Y95F Withdrawn from market Glutathione peroxidase 1 (GPX1) increases the Injury ADR of Cephaloridine. [61]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Glutathione peroxidase 1 (GPX1). [1]
------------------------------------------------------------------------------------
62 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the activity of Glutathione peroxidase 1 (GPX1). [2]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Glutathione peroxidase 1 (GPX1). [3]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Glutathione peroxidase 1 (GPX1). [4]
Doxorubicin DMVP5YE Approved Doxorubicin increases the expression of Glutathione peroxidase 1 (GPX1). [5]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Glutathione peroxidase 1 (GPX1). [6]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Glutathione peroxidase 1 (GPX1). [7]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Glutathione peroxidase 1 (GPX1). [8]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Glutathione peroxidase 1 (GPX1). [9]
Arsenic DMTL2Y1 Approved Arsenic affects the expression of Glutathione peroxidase 1 (GPX1). [10]
Quercetin DM3NC4M Approved Quercetin increases the expression of Glutathione peroxidase 1 (GPX1). [11]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the activity of Glutathione peroxidase 1 (GPX1). [12]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide decreases the expression of Glutathione peroxidase 1 (GPX1). [13]
Triclosan DMZUR4N Approved Triclosan affects the expression of Glutathione peroxidase 1 (GPX1). [14]
Methotrexate DM2TEOL Approved Methotrexate increases the expression of Glutathione peroxidase 1 (GPX1). [15]
Decitabine DMQL8XJ Approved Decitabine affects the expression of Glutathione peroxidase 1 (GPX1). [16]
Marinol DM70IK5 Approved Marinol increases the expression of Glutathione peroxidase 1 (GPX1). [17]
Selenium DM25CGV Approved Selenium decreases the expression of Glutathione peroxidase 1 (GPX1). [18]
Phenobarbital DMXZOCG Approved Phenobarbital decreases the expression of Glutathione peroxidase 1 (GPX1). [19]
Fluorouracil DMUM7HZ Approved Fluorouracil increases the expression of Glutathione peroxidase 1 (GPX1). [20]
Troglitazone DM3VFPD Approved Troglitazone increases the expression of Glutathione peroxidase 1 (GPX1). [21]
Etoposide DMNH3PG Approved Etoposide increases the expression of Glutathione peroxidase 1 (GPX1). [22]
Diclofenac DMPIHLS Approved Diclofenac increases the expression of Glutathione peroxidase 1 (GPX1). [23]
Nicotine DMWX5CO Approved Nicotine decreases the expression of Glutathione peroxidase 1 (GPX1). [24]
Indomethacin DMSC4A7 Approved Indomethacin increases the expression of Glutathione peroxidase 1 (GPX1). [23]
Mitoxantrone DMM39BF Approved Mitoxantrone increases the expression of Glutathione peroxidase 1 (GPX1). [25]
Daunorubicin DMQUSBT Approved Daunorubicin increases the expression of Glutathione peroxidase 1 (GPX1). [25]
Vitamin C DMXJ7O8 Approved Vitamin C increases the expression of Glutathione peroxidase 1 (GPX1). [26]
Bosentan DMIOGBU Approved Bosentan decreases the expression of Glutathione peroxidase 1 (GPX1). [27]
Aminoglutethimide DMWFHMZ Approved Aminoglutethimide increases the expression of Glutathione peroxidase 1 (GPX1). [28]
Aluminium DM6ECN9 Approved Aluminium decreases the activity of Glutathione peroxidase 1 (GPX1). [29]
Resveratrol DM3RWXL Phase 3 Resveratrol increases the expression of Glutathione peroxidase 1 (GPX1). [31]
Tamibarotene DM3G74J Phase 3 Tamibarotene affects the expression of Glutathione peroxidase 1 (GPX1). [32]
Epigallocatechin gallate DMCGWBJ Phase 3 Epigallocatechin gallate decreases the expression of Glutathione peroxidase 1 (GPX1). [33]
Fenretinide DMRD5SP Phase 3 Fenretinide increases the expression of Glutathione peroxidase 1 (GPX1). [34]
Genistein DM0JETC Phase 2/3 Genistein increases the expression of Glutathione peroxidase 1 (GPX1). [11]
Amiodarone DMUTEX3 Phase 2/3 Trial Amiodarone decreases the expression of Glutathione peroxidase 1 (GPX1). [35]
phorbol 12-myristate 13-acetate DMJWD62 Phase 2 phorbol 12-myristate 13-acetate increases the expression of Glutathione peroxidase 1 (GPX1). [36]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Glutathione peroxidase 1 (GPX1). [37]
MG-132 DMKA2YS Preclinical MG-132 increases the expression of Glutathione peroxidase 1 (GPX1). [38]
SB-431542 DM0YOXQ Preclinical SB-431542 increases the expression of Glutathione peroxidase 1 (GPX1). [39]
EMODIN DMAEDQG Terminated EMODIN increases the expression of Glutathione peroxidase 1 (GPX1). [40]
Nimesulide DMR1NMD Terminated Nimesulide decreases the expression of Glutathione peroxidase 1 (GPX1). [41]
NS398 DMINUWH Terminated NS398 increases the expression of Glutathione peroxidase 1 (GPX1). [41]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Glutathione peroxidase 1 (GPX1). [42]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of Glutathione peroxidase 1 (GPX1). [43]
Sulforaphane DMQY3L0 Investigative Sulforaphane decreases the expression of Glutathione peroxidase 1 (GPX1). [44]
chloropicrin DMSGBQA Investigative chloropicrin decreases the expression of Glutathione peroxidase 1 (GPX1). [45]
3R14S-OCHRATOXIN A DM2KEW6 Investigative 3R14S-OCHRATOXIN A decreases the expression of Glutathione peroxidase 1 (GPX1). [46]
Paraquat DMR8O3X Investigative Paraquat decreases the expression of Glutathione peroxidase 1 (GPX1). [47]
Hexadecanoic acid DMWUXDZ Investigative Hexadecanoic acid decreases the expression of Glutathione peroxidase 1 (GPX1). [48]
D-glucose DMMG2TO Investigative D-glucose decreases the expression of Glutathione peroxidase 1 (GPX1). [49]
Okadaic acid DM47CO1 Investigative Okadaic acid decreases the expression of Glutathione peroxidase 1 (GPX1). [50]
Cordycepin DM72Y01 Investigative Cordycepin decreases the expression of Glutathione peroxidase 1 (GPX1). [51]
Lead acetate DML0GZ2 Investigative Lead acetate increases the expression of Glutathione peroxidase 1 (GPX1). [52]
AM251 DMTAWHL Investigative AM251 increases the expression of Glutathione peroxidase 1 (GPX1). [53]
(E)-4-(3,5-dimethoxystyryl)phenol DMYXI2V Investigative (E)-4-(3,5-dimethoxystyryl)phenol increases the expression of Glutathione peroxidase 1 (GPX1). [54]
biochanin A DM0HPWY Investigative biochanin A decreases the expression of Glutathione peroxidase 1 (GPX1). [55]
ROSMARINIC ACID DMQ6SJT Investigative ROSMARINIC ACID increases the expression of Glutathione peroxidase 1 (GPX1). [52]
THIOCTIC ACID DMNFCXW Investigative THIOCTIC ACID increases the expression of Glutathione peroxidase 1 (GPX1). [56]
Indirubin-3'-monoxime DMLRQH0 Investigative Indirubin-3'-monoxime decreases the expression of Glutathione peroxidase 1 (GPX1). [57]
Lefaxin DM0CEY3 Investigative Lefaxin decreases the expression of Glutathione peroxidase 1 (GPX1). [58]
Mercaptosuccinate DM68FZK Investigative Mercaptosuccinate decreases the activity of Glutathione peroxidase 1 (GPX1). [59]
------------------------------------------------------------------------------------
⏷ Show the Full List of 62 Drug(s)
2 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT
Drug Name Drug ID Highest Status Interaction REF
Amlexanox DM0DQM5 Approved Amlexanox affects the localization of Glutathione peroxidase 1 (GPX1). [30]
G418 DMKTJBU Investigative G418 affects the localization of Glutathione peroxidase 1 (GPX1). [30]
------------------------------------------------------------------------------------

References

1 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2 Altered oxidative status and integrin expression in cyclosporine A-treated oral epithelial cells. Toxicol Mech Methods. 2015 Feb;25(2):98-104. doi: 10.3109/15376516.2014.990595. Epub 2015 Jan 22.
3 Pharmacogenomic analysis of acute promyelocytic leukemia cells highlights CYP26 cytochrome metabolism in differential all-trans retinoic acid sensitivity. Blood. 2007 May 15;109(10):4450-60.
4 Human 3D multicellular microtissues: an upgraded model for the in vitro mechanistic investigation of inflammation-associated drug toxicity. Toxicol Lett. 2019 Sep 15;312:34-44.
5 p53-induced up-regulation of MnSOD and GPx but not catalase increases oxidative stress and apoptosis. Cancer Res. 2004 Apr 1;64(7):2350-6. doi: 10.1158/0008-5472.can-2287-2.
6 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
7 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
8 Molecular mechanism of action of bisphenol and bisphenol A mediated by oestrogen receptor alpha in growth and apoptosis of breast cancer cells. Br J Pharmacol. 2013 May;169(1):167-78.
9 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
10 Combined effects of arsenic and palmitic acid on oxidative stress and lipid metabolism disorder in human hepatoma HepG2 cells. Sci Total Environ. 2021 May 15;769:144849. doi: 10.1016/j.scitotenv.2020.144849. Epub 2021 Jan 19.
11 A high-throughput reporter gene assay to prove the ability of natural compounds to modulate glutathione peroxidase, superoxide dismutase and catalase gene promoters in V79 cells. Free Radic Res. 2008 Aug;42(8):746-53.
12 Role of oxidative stress in the apoptosis of hepatocellular carcinoma induced by combination of arsenic trioxide and ascorbic acid. Acta Pharmacol Sin. 2006 Aug;27(8):1078-84.
13 Chromium III histidinate exposure modulates gene expression in HaCaT human keratinocytes exposed to oxidative stress. Biol Trace Elem Res. 2010 Oct;137(1):23-39.
14 The modulatory effect of triclosan on the reversion of the activated phenotype of LX-2 hepatic stellate cells. J Biochem Mol Toxicol. 2020 Jan;34(1):e22413. doi: 10.1002/jbt.22413. Epub 2019 Nov 12.
15 Methotrexate-related response on human peripheral blood mononuclear cells may be modulated by the Ala16Val-SOD2 gene polymorphism. PLoS One. 2014 Oct 20;9(10):e107299. doi: 10.1371/journal.pone.0107299. eCollection 2014.
16 Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
17 Genomic and proteomic analysis of the effects of cannabinoids on normal human astrocytes. Brain Res. 2008 Jan 29;1191:1-11.
18 Effects of Se-depletion on glutathione peroxidase and selenoprotein W gene expression in the colon. FEBS Lett. 2005 Jan 31;579(3):792-6. doi: 10.1016/j.febslet.2004.12.042.
19 Proteomic analysis of hepatic effects of phenobarbital in mice with humanized liver. Arch Toxicol. 2022 Oct;96(10):2739-2754. doi: 10.1007/s00204-022-03338-7. Epub 2022 Jul 26.
20 Apoptosis, cell cycle progression and gene expression in TP53-depleted HCT116 colon cancer cells in response to short-term 5-fluorouracil treatment. Int J Oncol. 2007 Dec;31(6):1491-500.
21 Increased sensitivity for troglitazone-induced cytotoxicity using a human in vitro co-culture model. Toxicol In Vitro. 2009 Oct;23(7):1387-95.
22 Cell death mechanisms of the anti-cancer drug etoposide on human cardiomyocytes isolated from pluripotent stem cells. Arch Toxicol. 2018 Apr;92(4):1507-1524.
23 Development of an alternative zebrafish model for drug-induced intestinal toxicity. J Appl Toxicol. 2018 Feb;38(2):259-273. doi: 10.1002/jat.3520. Epub 2017 Oct 13.
24 Nicotinic modulation of gene expression in SH-SY5Y neuroblastoma cells. Brain Res. 2006 Oct 20;1116(1):39-49.
25 Identification of genomic biomarkers for anthracycline-induced cardiotoxicity in human iPSC-derived cardiomyocytes: an in vitro repeated exposure toxicity approach for safety assessment. Arch Toxicol. 2016 Nov;90(11):2763-2777.
26 Galbanic acid: Induced antiproliferation in estrogen receptor-negative breast cancer cells and enhanced cellular redox state in the human dermal fibroblasts. J Biochem Mol Toxicol. 2019 Nov;33(11):e22402. doi: 10.1002/jbt.22402. Epub 2019 Oct 1.
27 Omics-based responses induced by bosentan in human hepatoma HepaRG cell cultures. Arch Toxicol. 2018 Jun;92(6):1939-1952.
28 Proteomic profile of aminoglutethimide-induced apoptosis in HL-60 cells: role of myeloperoxidase and arylamine free radicals. Chem Biol Interact. 2015 Sep 5;239:129-38.
29 Involvement of oxidative stress in the impairment in biliary secretory function induced by intraperitoneal administration of aluminum to rats. Biol Trace Elem Res. 2007 Jun;116(3):329-48.
30 Premature termination codon readthrough in human cells occurs in novel cytoplasmic foci and requires UPF proteins. J Cell Sci. 2017 Sep 15;130(18):3009-3022. doi: 10.1242/jcs.198176. Epub 2017 Jul 25.
31 Resveratrol modulates mRNA transcripts of genes related to redox metabolism and cell proliferation in non-small-cell lung carcinoma cells. Biol Chem. 2007 Feb;388(2):207-19.
32 Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
33 Impact of epigallocatechin gallate on gene expression profiles of human hepatocellular carcinoma cell lines BEL7404/ADM and BEL7402/5-FU. Ai Zheng. 2008 Oct;27(10):1056-64.
34 Glycogen synthase kinase 3 regulates cell death and survival signaling in tumor cells under redox stress. Neoplasia. 2014 Sep;16(9):710-22.
35 Study on Protection of Human Umbilical Vein Endothelial Cells from Amiodarone-Induced Damage by Intermedin through Activation of Wnt/-Catenin Signaling Pathway. Oxid Med Cell Longev. 2021 Aug 14;2021:8889408. doi: 10.1155/2021/8889408. eCollection 2021.
36 Thioredoxin reductase is the major selenoprotein expressed in human umbilical-vein endothelial cells and is regulated by protein kinase C. Biochem J. 1999 Aug 15;342 ( Pt 1):111-7.
37 Genotoxic effects of the cyanobacterial pentapeptide nodularin in HepG2 cells. Food Chem Toxicol. 2019 Feb;124:349-358.
38 The role of PSMB5 in sodium arsenite-induced oxidative stress in L-02 cells. Cell Stress Chaperones. 2020 May;25(3):533-540. doi: 10.1007/s12192-020-01104-1. Epub 2020 Apr 16.
39 Activin/nodal signaling switches the terminal fate of human embryonic stem cell-derived trophoblasts. J Biol Chem. 2015 Apr 3;290(14):8834-48.
40 Gene expression alteration during redox-dependent enhancement of arsenic cytotoxicity by emodin in HeLa cells. Cell Res. 2005 Jul;15(7):511-22.
41 Selective COX-2 inhibitors modulate cellular senescence in human dermal fibroblasts in a catalytic activity-independent manner. Mech Ageing Dev. 2008 Dec;129(12):706-13.
42 Bisphenol A modulates inflammation and proliferation pathway in human endometrial stromal cells by inducing oxidative stress. Reprod Toxicol. 2018 Oct;81:41-49.
43 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
44 Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
45 Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
46 Microphysiological system modeling of ochratoxin A-associated nephrotoxicity. Toxicology. 2020 Nov;444:152582. doi: 10.1016/j.tox.2020.152582. Epub 2020 Sep 6.
47 Brazil nut improves the oxidative metabolism of superoxide-hydrogen peroxide chemically-imbalanced human fibroblasts in a nutrigenomic manner. Food Chem Toxicol. 2018 Nov;121:519-526.
48 PPARgamma-dependent and -independent effects of rosiglitazone on lipotoxic human pancreatic islets. Biochem Biophys Res Commun. 2008 Feb 22;366(4):1096-101. doi: 10.1016/j.bbrc.2007.12.088. Epub 2007 Dec 26.
49 Imbalance in the antioxidant defence system and pro-genotoxic status induced by high glucose concentrations: In vitro testing in human liver cells. Toxicol In Vitro. 2020 Dec;69:105001. doi: 10.1016/j.tiv.2020.105001. Epub 2020 Sep 15.
50 Evaluation of okadaic acid toxicity in human retinal cells and zebrafish retinas. Toxicology. 2022 May 15;473:153209. doi: 10.1016/j.tox.2022.153209. Epub 2022 May 13.
51 Cordycepin induces apoptotic cell death of human brain cancer through the modulation of autophagy. Toxicol In Vitro. 2018 Feb;46:113-121.
52 Identification of lead-produced lipid hydroperoxides in human HepG2 cells and protection using rosmarinic and ascorbic acids with a reference to their regulatory roles on Nrf2-Keap1 antioxidant pathway. Chem Biol Interact. 2019 Dec 1;314:108847. doi: 10.1016/j.cbi.2019.108847. Epub 2019 Oct 11.
53 Cannabinoid derivatives induce cell death in pancreatic MIA PaCa-2 cells via a receptor-independent mechanism. FEBS Lett. 2006 Mar 20;580(7):1733-9.
54 Involvement of the Nrf2 pathway in the regulation of pterostilbene-induced apoptosis in HeLa cells via ER stress. J Pharmacol Sci. 2014;126(3):216-29.
55 Mechanisms of the growth inhibitory effects of the isoflavonoid biochanin A on LNCaP cells and xenografts. Prostate. 2002 Aug 1;52(3):201-12.
56 Cytoprotective effect of alpha-lipoic acid on paraquat-exposed human bronchial epithelial cells via activation of nuclear factor erythroid related factor-2 pathway. Biol Pharm Bull. 2013;36(5):802-11.
57 The effects of indirubin-3'-monoxime, a novel AHR ligand, on stress and toxicity-related gene/protein expression in human U937 cells undergoing differentiation and activation. J Immunotoxicol. 2006 Jan 1;3(1):1-10.
58 The Val16Ala-SOD2 polymorphism affects cyto-genotoxicity of pyridostigmine bromide on human peripheral blood mononuclear cells. Toxicol In Vitro. 2019 Oct;60:237-244.
59 Resveratrol attenuates apoptosis of pulmonary microvascular endothelial cells induced by high shear stress and proinflammatory factors. Hum Cell. 2011 Sep;24(3):127-33.
60 Overexpression of seleno-glutathione peroxidase by gene transfer enhances the resistance of T47D human breast cells to clastogenic oxidants. J Biol Chem. 1991 Nov 5;266(31):20752-60.
61 ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.