Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTEGUY7F)

• DOT Name: Semaphorin-3C (SEMA3C)
• Synonyms: Semaphorin-E; Sema E
• Gene Name: SEMA3C
• Related Disease:
  Childhood epilepsy with centrotemporal spikes
  Malaria
  Adult glioblastoma
  Breast cancer
  Breast carcinoma
  Breast disorder
  Breast neoplasm
  Castration-resistant prostate carcinoma
  Cervical cancer
  Cervical carcinoma
  Colorectal carcinoma
  Cryohydrocytosis
  Endometriosis
  Epithelial neoplasm
  Gastric cancer
  Glioblastoma multiforme
  Glioma
  Hepatocellular carcinoma
  Hyperglycemia
  Neoplasm
  Neurotrophic keratitis
  Oral cancer
  Pancreatic cancer
  Persistent truncus arteriosus
  Rheumatoid arthritis
  Squamous cell carcinoma
  Stomach cancer
  Hirschsprung disease
  Retinopathy
  Advanced cancer
  Malignant pleural mesothelioma
  Matthew-Wood syndrome
  Obesity
  Pancreatic ductal carcinoma
  Prostate cancer
  Prostate carcinoma
• UniProt ID: SEM3C_HUMAN
• Pfam ID: PF07679 ; PF01403
• Sequence:
  MAFRTICVLVGVFICSICVKGSSQPQARVYLTFDELRETKTSEYFSLSHHPLDYRILLMD
  EDQDRIYVGSKDHILSLNINNISQEALSVFWPASTIKVEECKMAGKDPTHGCGNFVRVIQ
  TFNRTHLYVCGSGAFSPVCTYLNRGRRSEDQVFMIDSKCESGKGRCSFNPNVNTVSVMIN
  EELFSGMYIDFMGTDAAIFRSLTKRNAVRTDQHNSKWLSEPMFVDAHVIPDGTDPNDAKV
  YFFFKEKLTDNNRSTKQIHSMIARICPNDTGGLRSLVNKWTTFLKARLVCSVTDEDGPET
  HFDELEDVFLLETDNPRTTLVYGIFTTSSSVFKGSAVCVYHLSDIQTVFNGPFAHKEGPN
  HQLISYQGRIPYPRPGTCPGGAFTPNMRTTKEFPDDVVTFIRNHPLMYNSIYPIHKRPLI
  VRIGTDYKYTKIAVDRVNAADGRYHVLFLGTDRGTVQKVVVLPTNNSVSGELILEELEVF
  KNHAPITTMKISSKKQQLYVSSNEGVSQVSLHRCHIYGTACADCCLARDPYCAWDGHSCS
  RFYPTGKRRSRRQDVRHGNPLTQCRGFNLKAYRNAAEIVQYGVKNNTTFLECAPKSPQAS
  IKWLLQKDKDRRKEVKLNERIIATSQGLLIRSVQGSDQGLYHCIATENSFKQTIAKINFK
  VLDSEMVAVVTDKWSPWTWASSVRALPFHPKDIMGAFSHSEMQMINQYCKDTRQQHQQGD
  ESQKMRGDYGKLKALINSRKSRNRRNQLPES
• Function: Binds to plexin family members and plays an important role in the regulation of developmental processes. Required for normal cardiovascular development during embryogenesis. Functions as attractant for growing axons, and thereby plays an important role in axon growth and axon guidance.
• Tissue Specificity: Expressed intensely in the heart, skeletal muscle, colon, small intestine, ovary, testis, and prostate. Faint expression ubiquitously among other organs, including brain.
• KEGG Pathway: Axon guidance (hsa04360)

Molecular Interaction Atlas (MIA) of This DOT

36 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Childhood epilepsy with centrotemporal spikes	DISKT2L5	Definitive	Genetic Variation	[1]
Malaria	DISQ9Y50	Definitive	Genetic Variation	[2]
Adult glioblastoma	DISVP4LU	Strong	Biomarker	[3]
Breast cancer	DIS7DPX1	Strong	Biomarker	[4]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[4]
Breast disorder	DISJTGMA	Strong	Altered Expression	[5]
Breast neoplasm	DISNGJLM	Strong	Altered Expression	[6]
Castration-resistant prostate carcinoma	DISVGAE6	Strong	Genetic Variation	[7]
Cervical cancer	DISFSHPF	Strong	Biomarker	[8]
Cervical carcinoma	DIST4S00	Strong	Biomarker	[8]
Colorectal carcinoma	DIS5PYL0	Strong	Genetic Variation	[9]
Cryohydrocytosis	DISMQHL3	Strong	Biomarker	[10]
Endometriosis	DISX1AG8	Strong	Biomarker	[11]
Epithelial neoplasm	DIS0T594	Strong	Altered Expression	[5]
Gastric cancer	DISXGOUK	Strong	Biomarker	[12]
Glioblastoma multiforme	DISK8246	Strong	Biomarker	[3]
Glioma	DIS5RPEH	Strong	Altered Expression	[13]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[14]
Hyperglycemia	DIS0BZB5	Strong	Biomarker	[15]
Neoplasm	DISZKGEW	Strong	Biomarker	[3]
Neurotrophic keratitis	DISQKEPD	Strong	Biomarker	[15]
Oral cancer	DISLD42D	Strong	Altered Expression	[5]
Pancreatic cancer	DISJC981	Strong	Biomarker	[16]
Persistent truncus arteriosus	DISRZ8EA	Strong	Biomarker	[17]
Rheumatoid arthritis	DISTSB4J	Strong	Biomarker	[18]
Squamous cell carcinoma	DISQVIFL	Strong	Altered Expression	[19]
Stomach cancer	DISKIJSX	Strong	Biomarker	[12]
Hirschsprung disease	DISUUSM1	moderate	Biomarker	[20]
Retinopathy	DISB4B0F	moderate	Biomarker	[21]
Advanced cancer	DISAT1Z9	Limited	Biomarker	[22]
Malignant pleural mesothelioma	DIST2R60	Limited	Altered Expression	[23]
Matthew-Wood syndrome	DISA7HR7	Limited	Altered Expression	[24]
Obesity	DIS47Y1K	Limited	Biomarker	[25]
Pancreatic ductal carcinoma	DIS26F9Q	Limited	Biomarker	[24]
Prostate cancer	DISF190Y	Limited	Biomarker	[22]
Prostate carcinoma	DISMJPLE	Limited	Biomarker	[22]

25 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Semaphorin-3C (SEMA3C).	[26]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Semaphorin-3C (SEMA3C).	[27]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Semaphorin-3C (SEMA3C).	[28]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Semaphorin-3C (SEMA3C).	[29]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Semaphorin-3C (SEMA3C).	[30]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Semaphorin-3C (SEMA3C).	[31]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Semaphorin-3C (SEMA3C).	[32]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Semaphorin-3C (SEMA3C).	[33]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Semaphorin-3C (SEMA3C).	[34]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Semaphorin-3C (SEMA3C).	[35]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Semaphorin-3C (SEMA3C).	[34]
Troglitazone	DM3VFPD	Approved	Troglitazone increases the expression of Semaphorin-3C (SEMA3C).	[37]
Irinotecan	DMP6SC2	Approved	Irinotecan increases the expression of Semaphorin-3C (SEMA3C).	[38]
Clorgyline	DMCEUJD	Approved	Clorgyline increases the expression of Semaphorin-3C (SEMA3C).	[39]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Semaphorin-3C (SEMA3C).	[40]
Fenretinide	DMRD5SP	Phase 3	Fenretinide increases the expression of Semaphorin-3C (SEMA3C).	[41]
Belinostat	DM6OC53	Phase 2	Belinostat increases the expression of Semaphorin-3C (SEMA3C).	[34]
Afimoxifene	DMFORDT	Phase 2	Afimoxifene increases the expression of Semaphorin-3C (SEMA3C).	[42]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Semaphorin-3C (SEMA3C).	[43]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Semaphorin-3C (SEMA3C).	[44]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Semaphorin-3C (SEMA3C).	[45]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Semaphorin-3C (SEMA3C).	[46]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Semaphorin-3C (SEMA3C).	[30]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Semaphorin-3C (SEMA3C).	[47]
Microcystin-LR	DMTMLRN	Investigative	Microcystin-LR decreases the expression of Semaphorin-3C (SEMA3C).	[48]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the methylation of Semaphorin-3C (SEMA3C).	[36]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Semaphorin-3C (SEMA3C).	[36]

References

• [1] The genetics of reading disability in an often excluded sample: novel loci suggested for reading disability in Rolandic epilepsy.PLoS One. 2012;7(7):e40696. doi: 10.1371/journal.pone.0040696. Epub 2012 Jul 18.
• [2] Evaluating the Causal Link Between Malaria Infection and Endemic Burkitt Lymphoma in Northern Uganda: A Mendelian Randomization Study.EBioMedicine. 2017 Nov;25:58-65. doi: 10.1016/j.ebiom.2017.09.037. Epub 2017 Oct 3.
• [3] The Anti-Tumorigenic Activity of Sema3C in the Chick Embryo Chorioallantoic Membrane Model.Int J Mol Sci. 2019 Nov 12;20(22):5672. doi: 10.3390/ijms20225672.
• [4] Silencing of semaphorin 3C suppresses cell proliferation and migration in MCF-7 breast cancer cells.Oncol Lett. 2017 Nov;14(5):5913-5917. doi: 10.3892/ol.2017.6920. Epub 2017 Sep 8.
• [5] The relationship between semaphorin 3C and microvessel density in the progression of breast and oral neoplasia.Exp Mol Pathol. 2015 Aug;99(1):19-24. doi: 10.1016/j.yexmp.2015.03.041. Epub 2015 Apr 21.
• [6] Correlation of MDR-1, nm23-H1 and H Sema E gene expression with histopathological findings and clinical outcome in ovarian and breast cancer patients.Anticancer Res. 2002 Jul-Aug;22(4):2275-80.
• [7] Non-coding and coding genomic variants distinguish prostate cancer, castration-resistant prostate cancer, familial prostate cancer, and metastatic castration-resistant prostate cancer from each other.Mol Carcinog. 2019 Jun;58(6):862-874. doi: 10.1002/mc.22975. Epub 2019 Jan 31.
• [8] SEMA3C Promotes Cervical Cancer Growth and Is Associated With Poor Prognosis.Front Oncol. 2019 Oct 9;9:1035. doi: 10.3389/fonc.2019.01035. eCollection 2019.
• [9] Contribution of rare germline copy number variations and common susceptibility loci in Lynch syndrome patients negative for mutations in the mismatch repair genes.Int J Cancer. 2016 Apr 15;138(8):1928-35. doi: 10.1002/ijc.29948. Epub 2015 Dec 28.
• [10] The association of semaphorins 3C, 5A and 6D with liver fibrosis stage in chronic hepatitis C.PLoS One. 2018 Dec 28;13(12):e0209481. doi: 10.1371/journal.pone.0209481. eCollection 2018.
• [11] Reduced Sympathetic Innervation in Endometriosis is Associated to Semaphorin 3C and 3F Expression.Mol Neurobiol. 2017 Sep;54(7):5131-5141. doi: 10.1007/s12035-016-0058-1. Epub 2016 Aug 24.
• [12] Semaphorin 3C is involved in the progression of gastric cancer.Cancer Sci. 2012 Nov;103(11):1961-6. doi: 10.1111/cas.12003. Epub 2012 Oct 15.
• [13] High level of Sema3C is associated with glioma malignancy.Diagn Pathol. 2015 Jun 2;10:58. doi: 10.1186/s13000-015-0298-9.
• [14] Identification of SOX4 target genes using phylogenetic footprinting-based prediction from expression microarrays suggests that overexpression of SOX4 potentiates metastasis in hepatocellular carcinoma.Oncogene. 2008 Sep 18;27(42):5578-89. doi: 10.1038/onc.2008.168. Epub 2008 May 26.
• [15] Opposing Effects of Neuropilin-1 and -2 on Sensory Nerve Regeneration in Wounded Corneas: Role of Sema3C in Ameliorating Diabetic Neurotrophic Keratopathy.Diabetes. 2019 Apr;68(4):807-818. doi: 10.2337/db18-1172. Epub 2019 Jan 24.
• [16] Semaphorin 3C drives epithelial-to-mesenchymal transition, invasiveness, and stem-like characteristics in prostate cells.Sci Rep. 2017 Sep 13;7(1):11501. doi: 10.1038/s41598-017-11914-6.
• [17] ENU induced mutations causing congenital cardiovascular anomalies.Development. 2004 Dec;131(24):6211-23. doi: 10.1242/dev.01543. Epub 2004 Nov 17.
• [18] Increased prevalence of semaphorin 3C, a repellent of sympathetic nerve fibers, in the synovial tissue of patients with rheumatoid arthritis.Arthritis Rheum. 2004 Apr;50(4):1156-63. doi: 10.1002/art.20110.
• [19] Identification of semaphorin E as a non-MDR drug resistance gene of human cancers.Proc Natl Acad Sci U S A. 1997 Dec 23;94(26):14713-8. doi: 10.1073/pnas.94.26.14713.
• [20] Effects of SEMA3 polymorphisms in Hirschsprung disease patients.Pediatr Surg Int. 2016 Nov;32(11):1025-1028. doi: 10.1007/s00383-016-3953-7. Epub 2016 Jul 28.
• [21] Semaphorin-3C signals through Neuropilin-1 and PlexinD1 receptors to inhibit pathological angiogenesis.EMBO Mol Med. 2015 Oct;7(10):1267-84. doi: 10.15252/emmm.201404922.
• [22] Semaphorin 3C as a Therapeutic Target in Prostate and Other Cancers.Int J Mol Sci. 2019 Feb 12;20(3):774. doi: 10.3390/ijms20030774.
• [23] L1CAM, INP10, P-cadherin, tPA and ITGB4 over-expression in malignant pleural mesotheliomas revealed by combined use of cDNA and tissue microarray.Carcinogenesis. 2005 Jan;26(1):17-25. doi: 10.1093/carcin/bgh276. Epub 2004 Sep 24.
• [24] Increased semaphorin 3c expression promotes tumor growth and metastasis in pancreatic ductal adenocarcinoma by activating the ERK1/2 signaling pathway.Cancer Lett. 2017 Jul 1;397:12-22. doi: 10.1016/j.canlet.2017.03.014. Epub 2017 Mar 14.
• [25] Peptide vaccine for semaphorin3E ameliorates systemic glucose intolerance in mice with dietary obesity.Sci Rep. 2019 Mar 7;9(1):3858. doi: 10.1038/s41598-019-40325-y.
• [26] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [27] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [28] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [29] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [30] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [31] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [32] Hypoxia-inducible factor-1 (HIF-1) pathway activation by quercetin in human lens epithelial cells. Exp Eye Res. 2009 Dec;89(6):995-1002. doi: 10.1016/j.exer.2009.08.011. Epub 2009 Sep 1.
• [33] 1,25-Dihydroxyvitamin D3 suppresses gene expression of eukaryotic translation initiation factor 2 in human promyelocytic leukemia HL-60 cells. Cell Struct Funct. 2005;30(1):1-6. doi: 10.1247/csf.30.1.
• [34] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [35] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [36] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [37] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [38] Clinical determinants of response to irinotecan-based therapy derived from cell line models. Clin Cancer Res. 2008 Oct 15;14(20):6647-55.
• [39] Anti-oncogenic and pro-differentiation effects of clorgyline, a monoamine oxidase A inhibitor, on high grade prostate cancer cells. BMC Med Genomics. 2009 Aug 20;2:55. doi: 10.1186/1755-8794-2-55.
• [40] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [41] The transforming growth factor-beta family members bone morphogenetic protein-2 and macrophage inhibitory cytokine-1 as mediators of the antiangiogenic activity of N-(4-hydroxyphenyl)retinamide. Clin Cancer Res. 2005 Jun 15;11(12):4610-9.
• [42] Regulation of aryl hydrocarbon receptor function by selective estrogen receptor modulators. Mol Endocrinol. 2010 Jan;24(1):33-46.
• [43] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [44] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [45] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [46] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [47] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [48] Cytotoxic Effects of Environmental Toxins on Human Glial Cells. Neurotox Res. 2017 Feb;31(2):245-258. doi: 10.1007/s12640-016-9678-5. Epub 2016 Oct 29.