Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTF4VS5G)

• DOT Name: Brain acid soluble protein 1 (BASP1)
• Synonyms: 22 kDa neuronal tissue-enriched acidic protein; Neuronal axonal membrane protein NAP-22
• Gene Name: BASP1
• Related Disease:
  Neoplasm
  Acute myelogenous leukaemia
  Breast cancer
  Breast carcinoma
  Cervical cancer
  Cervical carcinoma
  Diabetic kidney disease
  Hepatocellular carcinoma
  Mobius syndrome
  Myeloid leukaemia
  Prostate cancer
  Prostate carcinoma
  Pancreatic cancer
  Carcinoma
  Childhood kidney Wilms tumor
  Melanoma
  Thyroid cancer
  Thyroid gland carcinoma
  Thyroid tumor
  Undifferentiated carcinoma
  Wilms tumor
• UniProt ID: BASP1_HUMAN
• Pfam ID: PF05466
• Sequence:
  MGGKLSKKKKGYNVNDEKAKEKDKKAEGAATEEEGTPKESEPQAAAEPAEAKEGKEKPDQ
  DAEGKAEEKEGEKDAAAAKEEAPKAEPEKTEGAAEAKAEPPKAPEQEQAAPGPAAGGEAP
  KAAEAAAAPAESAAPAAGEEPSKEEGEPKKTEAPAAPAAQETKSDGAPASDSKPGSSEAA
  PSSKETPAATEAPSSTPKAQGPAASAEEPKPVEAPAANSDQTVTVKE
• Tissue Specificity: Brain.
• Reactome Pathway: RHOF GTPase cycle (R-HSA-9035034)

Molecular Interaction Atlas (MIA) of This DOT

21 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Neoplasm	DISZKGEW	Definitive	Altered Expression	[1]
Acute myelogenous leukaemia	DISCSPTN	Strong	Biomarker	[2]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[3]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[3]
Cervical cancer	DISFSHPF	Strong	Altered Expression	[4]
Cervical carcinoma	DIST4S00	Strong	Altered Expression	[4]
Diabetic kidney disease	DISJMWEY	Strong	Biomarker	[5]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[6]
Mobius syndrome	DIS9YXP5	Strong	Biomarker	[7]
Myeloid leukaemia	DISMN944	Strong	Altered Expression	[8]
Prostate cancer	DISF190Y	Strong	Biomarker	[9]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[9]
Pancreatic cancer	DISJC981	moderate	Biomarker	[10]
Carcinoma	DISH9F1N	Limited	Biomarker	[11]
Childhood kidney Wilms tumor	DIS0NMK3	Limited	Altered Expression	[1]
Melanoma	DIS1RRCY	Limited	Altered Expression	[12]
Thyroid cancer	DIS3VLDH	Limited	Altered Expression	[13]
Thyroid gland carcinoma	DISMNGZ0	Limited	Altered Expression	[13]
Thyroid tumor	DISLVKMD	Limited	Altered Expression	[13]
Undifferentiated carcinoma	DISIAZST	Limited	Biomarker	[11]
Wilms tumor	DISB6T16	Limited	Altered Expression	[1]

19 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Brain acid soluble protein 1 (BASP1).	[14]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Brain acid soluble protein 1 (BASP1).	[15]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Brain acid soluble protein 1 (BASP1).	[16]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Brain acid soluble protein 1 (BASP1).	[17]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Brain acid soluble protein 1 (BASP1).	[18]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Brain acid soluble protein 1 (BASP1).	[19]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Brain acid soluble protein 1 (BASP1).	[20]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Brain acid soluble protein 1 (BASP1).	[21]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Brain acid soluble protein 1 (BASP1).	[22]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Brain acid soluble protein 1 (BASP1).	[23]
Isotretinoin	DM4QTBN	Approved	Isotretinoin increases the expression of Brain acid soluble protein 1 (BASP1).	[24]
Aminoglutethimide	DMWFHMZ	Approved	Aminoglutethimide decreases the expression of Brain acid soluble protein 1 (BASP1).	[25]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Brain acid soluble protein 1 (BASP1).	[18]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the expression of Brain acid soluble protein 1 (BASP1).	[28]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Brain acid soluble protein 1 (BASP1).	[29]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Brain acid soluble protein 1 (BASP1).	[18]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Brain acid soluble protein 1 (BASP1).	[23]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Brain acid soluble protein 1 (BASP1).	[30]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Brain acid soluble protein 1 (BASP1).	[32]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Brain acid soluble protein 1 (BASP1).	[26]
TAK-243	DM4GKV2	Phase 1	TAK-243 decreases the sumoylation of Brain acid soluble protein 1 (BASP1).	[27]
Coumarin	DM0N8ZM	Investigative	Coumarin decreases the phosphorylation of Brain acid soluble protein 1 (BASP1).	[31]
Hexadecanoic acid	DMWUXDZ	Investigative	Hexadecanoic acid decreases the phosphorylation of Brain acid soluble protein 1 (BASP1).	[33]

References

• [1] A Unique Family of Neuronal Signaling Proteins Implicated in Oncogenesis and Tumor Suppression.Front Oncol. 2019 Apr 17;9:289. doi: 10.3389/fonc.2019.00289. eCollection 2019.
• [2] Methylation-associated silencing of BASP1 contributes to leukemogenesis in t(8;21) acute myeloid leukemia.Exp Mol Med. 2018 Apr 20;50(4):1-8. doi: 10.1038/s12276-018-0067-4.
• [3] BASP1 interacts with oestrogen receptor and modifies the tamoxifen response.Cell Death Dis. 2017 May 11;8(5):e2771. doi: 10.1038/cddis.2017.179.
• [4] High brain acid soluble protein 1(BASP1) is a poor prognostic factor for cervical cancer and promotes tumor growth.Cancer Cell Int. 2017 Oct 24;17:97. doi: 10.1186/s12935-017-0452-4. eCollection 2017.
• [5] BASP1 promotes apoptosis in diabetic nephropathy.J Am Soc Nephrol. 2010 Apr;21(4):610-21. doi: 10.1681/ASN.2009020227. Epub 2010 Jan 28.
• [6] The assessment of methylated BASP1 and SRD5A2 levels in the detection of early hepatocellular carcinoma.Int J Oncol. 2010 Jan;36(1):205-12.
• [7] Mutational screening of BASP1 and transcribed processed pseudogene TPPsig-BASP1 in patients with Mbius syndrome.J Genet Genomics. 2009 Apr;36(4):251-6. doi: 10.1016/S1673-8527(08)60112-5.
• [8] WT1 and its transcriptional cofactor BASP1 redirect the differentiation pathway of an established blood cell line.Biochem J. 2011 Apr 1;435(1):113-25. doi: 10.1042/BJ20101734.
• [9] Genistein treatment duration effects biomarkers of cell motility in human prostate.PLoS One. 2019 Mar 27;14(3):e0214078. doi: 10.1371/journal.pone.0214078. eCollection 2019.
• [10] Quantitative proteomics identifies brain acid soluble protein 1 (BASP1) as a prognostic biomarker candidate in pancreatic cancer tissue.EBioMedicine. 2019 May;43:282-294. doi: 10.1016/j.ebiom.2019.04.008. Epub 2019 Apr 11.
• [11] cDNA microarray profiling of rat mammary gland carcinomas induced by 2-amino-1-methyl-6-phenylimidazo[4,5-b]pyridine and 7,12-dimethylbenz[a]anthracene.Carcinogenesis. 2002 Oct;23(10):1561-8. doi: 10.1093/carcin/23.10.1561.
• [12] Two-stage genome-wide association study identifies a novel susceptibility locus associated with melanoma.Oncotarget. 2017 Mar 14;8(11):17586-17592. doi: 10.18632/oncotarget.15230.
• [13] Restoration of Brain Acid Soluble Protein 1 Inhibits Proliferation and Migration of Thyroid Cancer Cells.Chin Med J (Engl). 2016 Jun 20;129(12):1439-46. doi: 10.4103/0366-6999.183434.
• [14] Effects of valproic acid on gene expression during human embryonic stem cell differentiation into neurons. J Toxicol Sci. 2014 Jun;39(3):383-90. doi: 10.2131/jts.39.383.
• [15] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [16] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [17] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [18] Convergent transcriptional profiles induced by endogenous estrogen and distinct xenoestrogens in breast cancer cells. Carcinogenesis. 2006 Aug;27(8):1567-78.
• [19] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [20] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [21] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [22] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [23] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [24] Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
• [25] Proteomic profile of aminoglutethimide-induced apoptosis in HL-60 cells: role of myeloperoxidase and arylamine free radicals. Chem Biol Interact. 2015 Sep 5;239:129-38.
• [26] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [27] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [28] Comparative proteomics reveals concordant and discordant biochemical effects of caffeine versus epigallocatechin-3-gallate in human endothelial cells. Toxicol Appl Pharmacol. 2019 Sep 1;378:114621. doi: 10.1016/j.taap.2019.114621. Epub 2019 Jun 10.
• [29] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [30] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [31] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [32] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [33] Functional lipidomics: Palmitic acid impairs hepatocellular carcinoma development by modulating membrane fluidity and glucose metabolism. Hepatology. 2017 Aug;66(2):432-448. doi: 10.1002/hep.29033. Epub 2017 Jun 16.