Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTH88TXU)

• DOT Name: Disintegrin and metalloproteinase domain-containing protein 19 (ADAM19)
• Synonyms: ADAM 19; EC 3.4.24.-; Meltrin-beta; Metalloprotease and disintegrin dendritic antigen marker; MADDAM
• Gene Name: ADAM19
• Related Disease:
  Gastric cancer
  Prostate cancer
  Prostate carcinoma
  Stomach cancer
  Adult lymphoma
  Alzheimer disease
  Angiosarcoma
  Chronic obstructive pulmonary disease
  Colorectal carcinoma
  Epithelial ovarian cancer
  Lymphoma
  Nephropathy
  Non-insulin dependent diabetes
  Non-small-cell lung cancer
  Obesity
  Ovarian cancer
  Ovarian neoplasm
  Pediatric lymphoma
  Polymyositis
  Retinoblastoma
  Carcinoma
  Mental disorder
  Psychotic disorder
  Adult glioblastoma
  Autosomal recessive congenital ichthyosis 6
  Glioblastoma multiforme
• UniProt ID: ADA19_HUMAN
• EC Number: 3.4.24.-
• Pfam ID: PF08516 ; PF00200 ; PF01562 ; PF01421
• Sequence:
  MPGGAGAARLCLLAFALQPLRPRAAREPGWTRGSEEGSPKLQHELIIPQWKTSESPVREK
  HPLKAELRVMAEGRELILDLEKNEQLFAPSYTETHYTSSGNPQTTTRKLEDHCFYHGTVR
  ETELSSVTLSTCRGIRGLITVSSNLSYVIEPLPDSKGQHLIYRSEHLKPPPGNCGFEHSK
  PTTRDWALQFTQQTKKRPRRMKREDLNSMKYVELYLVADYLEFQKNRRDQDATKHKLIEI
  ANYVDKFYRSLNIRIALVGLEVWTHGNMCEVSENPYSTLWSFLSWRRKLLAQKYHDNAQL
  ITGMSFHGTTIGLAPLMAMCSVYQSGGVNMDHSENAIGVAATMAHEMGHNFGMTHDSADC
  CSASAADGGCIMAAATGHPFPKVFNGCNRRELDRYLQSGGGMCLSNMPDTRMLYGGRRCG
  NGYLEDGEECDCGEEEECNNPCCNASNCTLRPGAECAHGSCCHQCKLLAPGTLCREQARQ
  CDLPEFCTGKSPHCPTNFYQMDGTPCEGGQAYCYNGMCLTYQEQCQQLWGPGARPAPDLC
  FEKVNVAGDTFGNCGKDMNGEHRKCNMRDAKCGKIQCQSSEARPLESNAVPIDTTIIMNG
  RQIQCRGTHVYRGPEEEGDMLDPGLVMTGTKCGYNHICFEGQCRNTSFFETEGCGKKCNG
  HGVCNNNQNCHCLPGWAPPFCNTPGHGGSIDSGPMPPESVGPVVAGVLVAILVLAVLMLM
  YYCCRQNNKLGQLKPSALPSKLRQQFSCPFRVSQNSGTGHANPTFKLQTPQGKRKVINTP
  EILRKPSQPPPRPPPDYLRGGSPPAPLPAHLSRAARNSPGPGSQIERTESSRRPPPSRPI
  PPAPNCIVSQDFSRPRPPQKALPANPVPGRRSLPRPGGASPLRPPGAGPQQSRPLAALAP
  KVSPREALKVKAGTRGLQGGRCRVEKTKQFMLLVVWTELPEQKPRAKHSCFLVPA
• Function: Participates in the proteolytic processing of beta-type neuregulin isoforms which are involved in neurogenesis and synaptogenesis, suggesting a regulatory role in glial cell. Also cleaves alpha-2 macroglobulin. May be involved in osteoblast differentiation and/or osteoblast activity in bone.
• Tissue Specificity: Expressed in many normal organ tissues and several cancer cell lines.
• Reactome Pathway:
  Regulation of CDH11 function (R-HSA-9762292)
  Invadopodia formation (R-HSA-8941237)

Molecular Interaction Atlas (MIA) of This DOT

26 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Gastric cancer	DISXGOUK	Definitive	Biomarker	[1]
Prostate cancer	DISF190Y	Definitive	Altered Expression	[2]
Prostate carcinoma	DISMJPLE	Definitive	Altered Expression	[2]
Stomach cancer	DISKIJSX	Definitive	Biomarker	[1]
Adult lymphoma	DISK8IZR	Strong	Genetic Variation	[3]
Alzheimer disease	DISF8S70	Strong	Biomarker	[4]
Angiosarcoma	DISIYS9W	Strong	Biomarker	[5]
Chronic obstructive pulmonary disease	DISQCIRF	Strong	Genetic Variation	[6]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[7]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[8]
Lymphoma	DISN6V4S	Strong	Genetic Variation	[3]
Nephropathy	DISXWP4P	Strong	Biomarker	[9]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Altered Expression	[10]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[11]
Obesity	DIS47Y1K	Strong	Biomarker	[10]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[8]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[8]
Pediatric lymphoma	DIS51BK2	Strong	Genetic Variation	[3]
Polymyositis	DIS5DHFP	Strong	Biomarker	[12]
Retinoblastoma	DISVPNPB	Strong	Biomarker	[13]
Carcinoma	DISH9F1N	moderate	Biomarker	[14]
Mental disorder	DIS3J5R8	moderate	Genetic Variation	[15]
Psychotic disorder	DIS4UQOT	moderate	Genetic Variation	[15]
Adult glioblastoma	DISVP4LU	Limited	Biomarker	[16]
Autosomal recessive congenital ichthyosis 6	DIS9HRE9	Limited	CausalMutation	[17]
Glioblastoma multiforme	DISK8246	Limited	Biomarker	[16]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Camptothecin	DM6CHNJ	Phase 3	Disintegrin and metalloproteinase domain-containing protein 19 (ADAM19) decreases the response to substance of Camptothecin.	[40]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Disintegrin and metalloproteinase domain-containing protein 19 (ADAM19).	[18]

22 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Disintegrin and metalloproteinase domain-containing protein 19 (ADAM19).	[19]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Disintegrin and metalloproteinase domain-containing protein 19 (ADAM19).	[20]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Disintegrin and metalloproteinase domain-containing protein 19 (ADAM19).	[21]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Disintegrin and metalloproteinase domain-containing protein 19 (ADAM19).	[22]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Disintegrin and metalloproteinase domain-containing protein 19 (ADAM19).	[23]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Disintegrin and metalloproteinase domain-containing protein 19 (ADAM19).	[24]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Disintegrin and metalloproteinase domain-containing protein 19 (ADAM19).	[25]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Disintegrin and metalloproteinase domain-containing protein 19 (ADAM19).	[26]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Disintegrin and metalloproteinase domain-containing protein 19 (ADAM19).	[27]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Disintegrin and metalloproteinase domain-containing protein 19 (ADAM19).	[28]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Disintegrin and metalloproteinase domain-containing protein 19 (ADAM19).	[29]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Disintegrin and metalloproteinase domain-containing protein 19 (ADAM19).	[30]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Disintegrin and metalloproteinase domain-containing protein 19 (ADAM19).	[31]
Irinotecan	DMP6SC2	Approved	Irinotecan increases the expression of Disintegrin and metalloproteinase domain-containing protein 19 (ADAM19).	[32]
Nicotine	DMWX5CO	Approved	Nicotine increases the expression of Disintegrin and metalloproteinase domain-containing protein 19 (ADAM19).	[33]
PD-0325901	DM27D4J	Phase 2	PD-0325901 decreases the expression of Disintegrin and metalloproteinase domain-containing protein 19 (ADAM19).	[34]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Disintegrin and metalloproteinase domain-containing protein 19 (ADAM19).	[35]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Disintegrin and metalloproteinase domain-containing protein 19 (ADAM19).	[34]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Disintegrin and metalloproteinase domain-containing protein 19 (ADAM19).	[36]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Disintegrin and metalloproteinase domain-containing protein 19 (ADAM19).	[37]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Disintegrin and metalloproteinase domain-containing protein 19 (ADAM19).	[38]
Phencyclidine	DMQBEYX	Investigative	Phencyclidine decreases the expression of Disintegrin and metalloproteinase domain-containing protein 19 (ADAM19).	[39]

References

• [1] Analysis of the clinical significance of DNA methylation in gastric cancer based on a genome-wide high-resolution array.Clin Epigenetics. 2019 Nov 1;11(1):154. doi: 10.1186/s13148-019-0747-5.
• [2] Genetic and cellular studies highlight that A Disintegrin and Metalloproteinase 19 is a protective biomarker in human prostate cancer.BMC Cancer. 2016 Feb 24;16:151. doi: 10.1186/s12885-016-2178-4.
• [3] Polymorphisms in integrin genes and lymphoma risk.Leuk Res. 2011 Jul;35(7):968-70. doi: 10.1016/j.leukres.2010.12.012. Epub 2011 Jan 15.
• [4] ADAM19 is tightly associated with constitutive Alzheimer's disease APP alpha-secretase in A172 cells.Biochem Biophys Res Commun. 2007 Jan 5;352(1):111-7. doi: 10.1016/j.bbrc.2006.10.181. Epub 2006 Nov 9.
• [5] Biallelic Dicer1 Loss Mediated by aP2-Cre Drives Angiosarcoma.Cancer Res. 2017 Nov 15;77(22):6109-6118. doi: 10.1158/0008-5472.CAN-17-1262. Epub 2017 Sep 15.
• [6] Genetic landscape of chronic obstructive pulmonary disease identifies heterogeneous cell-type and phenotype associations.Nat Genet. 2019 Mar;51(3):494-505. doi: 10.1038/s41588-018-0342-2. Epub 2019 Feb 25.
• [7] Role of microRNA-30c targeting ADAM19 in colorectal cancer.PLoS One. 2015 Mar 23;10(3):e0120698. doi: 10.1371/journal.pone.0120698. eCollection 2015.
• [8] Promoter hypermethylation of FBXO32, a novel TGF-beta/SMAD4 target gene and tumor suppressor, is associated with poor prognosis in human ovarian cancer.Lab Invest. 2010 Mar;90(3):414-25. doi: 10.1038/labinvest.2009.138. Epub 2010 Jan 11.
• [9] ADAM19 expression in human nephrogenesis and renal disease: associations with clinical and structural deterioration.Kidney Int. 2006 Oct;70(7):1269-78. doi: 10.1038/sj.ki.5001753. Epub 2006 Aug 9.
• [10] ADAM19: A Novel Target for Metabolic Syndrome in Humans and Mice.Mediators Inflamm. 2017;2017:7281986. doi: 10.1155/2017/7281986. Epub 2017 Feb 7.
• [11] MiR-145 changes sensitivity of non-small cell lung cancer to gefitinib through targeting ADAM19.Eur Rev Med Pharmacol Sci. 2019 Jul;23(13):5831-5839. doi: 10.26355/eurrev_201907_18323.
• [12] The cell-specific expression of metalloproteinase-disintegrins (ADAMs) in inflammatory myopathies.Neurobiol Dis. 2007 Mar;25(3):665-74. doi: 10.1016/j.nbd.2006.11.008. Epub 2007 Jan 3.
• [13] MiR-145 suppressed human retinoblastoma cell proliferation and invasion by targeting ADAM19.Int J Clin Exp Pathol. 2015 Nov 1;8(11):14521-7. eCollection 2015.
• [14] EMT is associated with an epigenetic signature of ECM remodeling genes.Cell Death Dis. 2019 Feb 27;10(3):205. doi: 10.1038/s41419-019-1397-4.
• [15] A genome-wide meta-analysis identifies novel loci associated with schizophrenia and bipolar disorder.Schizophr Res. 2010 Dec;124(1-3):192-9. doi: 10.1016/j.schres.2010.09.002.
• [16] MiR-145 inhibits the epithelial-to-mesenchymal transition via targeting ADAM19 in human glioblastoma.Oncotarget. 2017 Sep 30;8(54):92545-92554. doi: 10.18632/oncotarget.21442. eCollection 2017 Nov 3.
• [17] Role of molecular testing in the multidisciplinary diagnostic approach of ichthyosis.Orphanet J Rare Dis. 2016 Jan 13;11:4. doi: 10.1186/s13023-016-0384-4.
• [18] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [19] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [20] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [21] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [22] Multiple pathways are involved in drug resistance to doxorubicin in an osteosarcoma cell line. Anticancer Drugs. 2008 Mar;19(3):257-65.
• [23] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [24] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [25] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [26] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [27] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [28] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [29] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [30] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [31] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [32] Clinical determinants of response to irinotecan-based therapy derived from cell line models. Clin Cancer Res. 2008 Oct 15;14(20):6647-55.
• [33] Characterizing the genetic basis for nicotine induced cancer development: a transcriptome sequencing study. PLoS One. 2013 Jun 18;8(6):e67252.
• [34] PRC2 loss amplifies Ras-driven transcription and confers sensitivity to BRD4-based therapies. Nature. 2014 Oct 9;514(7521):247-51.
• [35] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [36] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [37] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [38] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
• [39] Microarray Analysis of Gene Expression Alteration in Human Middle Ear Epithelial Cells Induced by Asian Sand Dust. Clin Exp Otorhinolaryngol. 2015 Dec;8(4):345-53. doi: 10.3342/ceo.2015.8.4.345. Epub 2015 Nov 10.
• [40] ATR inhibitors VE-821 and VX-970 sensitize cancer cells to topoisomerase i inhibitors by disabling DNA replication initiation and fork elongation responses. Cancer Res. 2014 Dec 1;74(23):6968-79.