Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJ0I7HJ)

• DOT Name: Neurexin-3-beta (NRXN3)
• Synonyms: Neurexin III-beta
• Gene Name: NRXN3
• Related Disease:
  Bipolar I disorder
  Fibromyalgia
  Pervasive developmental disorder
  Alcohol dependence
  Alzheimer disease
  Cholelithiasis
  Cluster headache
  Drug dependence
  Epilepsy
  Familial Alzheimer disease
  Glioma
  Graves disease
  Nicotine dependence
  Non-insulin dependent diabetes
  Schizophrenia
  Substance abuse
  Substance dependence
  Breast cancer
  Breast carcinoma
  Clear cell renal carcinoma
  Neurodevelopmental disorder
  Opioid dependence
  Renal cell carcinoma
  Adenocarcinoma
  Adenoma
  Autism
  Autism spectrum disorder
  Intellectual disability
  Tauopathy
• UniProt ID: NRX3B_HUMAN
• Pfam ID: PF02210 ; PF01034
• Sequence:
  MHLRIHARRSPPRRPAWTLGIWFLFWGCIVSSVWSSSNVASSSSTSSSPGSHSQHEHHFH
  GSKHHSVPISIYRSPVSLRGGHAGATYIFGKSGGLILYTWPANDRPSTRSDRLAVGFSTT
  VKDGILVRIDSAPGLGDFLQLHIEQGKIGVVFNIGTVDISIKEERTPVNDGKYHVVRFTR
  NGGNATLQVDNWPVNEHYPTGRQLTIFNTQAQIAIGGKDKGRLFQGQLSGLYYDGLKVLN
  MAAENNPNIKINGSVRLVGEVPSILGTTQTTSMPPEMSTTVMETTTTMATTTTRKNRSTA
  SIQPTSDDLVSSAECSSDDEDFVECEPSTGGELVIPLLVEDPLATPPIATRAPSITLPPT
  FRPLLTIIETTKDSLSMTSEAGLPCLSDQGSDGCDDDGLVISGYGSGETFDSNLPPTDDE
  DFYTTFSLVTDKSLSTSIFEGGYKAHAPKWESKDFRPNKVSETSRTTTTSLSPELIRFTA
  SSSSGMVPKLPAGKMNNRDLKPQPDIVLLPLPTAYELDSTKLKSPLITSPMFRNVPTANP
  TEPGIRRVPGASEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYQVDETR
  NYISNSAQSNGTLMKEKQQSSKSGHKKQKNKDREYYV
• Function: Neuronal cell surface protein that may be involved in cell recognition and cell adhesion. May mediate intracellular signaling.
• Tissue Specificity: Expressed in the blood vessel walls (at protein level).
• KEGG Pathway: Cell adhesion molecules (hsa04514)
• Reactome Pathway: Neurexins and neuroligins (R-HSA-6794361)

Molecular Interaction Atlas (MIA) of This DOT

29 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Bipolar I disorder	DISD09EH	Definitive	Genetic Variation	[1]
Fibromyalgia	DISZJDS2	Definitive	Biomarker	[2]
Pervasive developmental disorder	DIS51975	Definitive	Genetic Variation	[3]
Alcohol dependence	DIS4ZSCO	Strong	Biomarker	[4]
Alzheimer disease	DISF8S70	Strong	Biomarker	[5]
Cholelithiasis	DISERLZB	Strong	Genetic Variation	[6]
Cluster headache	DISKAXY9	Strong	Genetic Variation	[7]
Drug dependence	DIS9IXRC	Strong	Biomarker	[8]
Epilepsy	DISBB28L	Strong	Genetic Variation	[9]
Familial Alzheimer disease	DISE75U4	Strong	Biomarker	[10]
Glioma	DIS5RPEH	Strong	Altered Expression	[11]
Graves disease	DISU4KOQ	Strong	Genetic Variation	[12]
Nicotine dependence	DISZD9W7	Strong	Biomarker	[13]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Genetic Variation	[14]
Schizophrenia	DISSRV2N	Strong	Genetic Variation	[5]
Substance abuse	DIS327VW	Strong	Biomarker	[8]
Substance dependence	DISDRAAR	Strong	Biomarker	[8]
Breast cancer	DIS7DPX1	moderate	Genetic Variation	[15]
Breast carcinoma	DIS2UE88	moderate	Genetic Variation	[15]
Clear cell renal carcinoma	DISBXRFJ	moderate	Altered Expression	[16]
Neurodevelopmental disorder	DIS372XH	moderate	Genetic Variation	[17]
Opioid dependence	DIS6WEHK	moderate	Genetic Variation	[4]
Renal cell carcinoma	DISQZ2X8	moderate	Altered Expression	[16]
Adenocarcinoma	DIS3IHTY	Disputed	Genetic Variation	[18]
Adenoma	DIS78ZEV	Disputed	Genetic Variation	[18]
Autism	DISV4V1Z	Limited	Autosomal dominant	[3]
Autism spectrum disorder	DISXK8NV	Limited	Biomarker	[19]
Intellectual disability	DISMBNXP	Limited	Biomarker	[20]
Tauopathy	DISY2IPA	Limited	Genetic Variation	[21]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Neurexin-3-beta (NRXN3).	[22]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Neurexin-3-beta (NRXN3).	[35]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Neurexin-3-beta (NRXN3).	[38]

16 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Neurexin-3-beta (NRXN3).	[23]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Neurexin-3-beta (NRXN3).	[24]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Neurexin-3-beta (NRXN3).	[25]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Neurexin-3-beta (NRXN3).	[26]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Neurexin-3-beta (NRXN3).	[27]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Neurexin-3-beta (NRXN3).	[28]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Neurexin-3-beta (NRXN3).	[29]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Neurexin-3-beta (NRXN3).	[30]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Neurexin-3-beta (NRXN3).	[31]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Neurexin-3-beta (NRXN3).	[32]
Dasatinib	DMJV2EK	Approved	Dasatinib increases the expression of Neurexin-3-beta (NRXN3).	[33]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Neurexin-3-beta (NRXN3).	[34]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Neurexin-3-beta (NRXN3).	[36]
PMID28870136-Compound-48	DMPIM9L	Patented	PMID28870136-Compound-48 increases the expression of Neurexin-3-beta (NRXN3).	[37]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Neurexin-3-beta (NRXN3).	[28]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Neurexin-3-beta (NRXN3).	[39]

References

• [1] Identification of novel loci for bipolar I disorder in a multi-stage genome-wide association study.Prog Neuropsychopharmacol Biol Psychiatry. 2014 Jun 3;51:58-64. doi: 10.1016/j.pnpbp.2014.01.003. Epub 2014 Jan 18.
• [2] Fibromyalgia: Genetics and epigenetics insights may provide the basis for the development of diagnostic biomarkers.Mol Pain. 2019 Jan-Dec;15:1744806918819944. doi: 10.1177/1744806918819944. Epub 2018 Nov 29.
• [3] Rare deletions at the neurexin 3 locus in autism spectrum disorder. Am J Hum Genet. 2012 Jan 13;90(1):133-41. doi: 10.1016/j.ajhg.2011.11.025. Epub 2011 Dec 29.
• [4] Neurexin 3 polymorphisms are associated with alcohol dependence and altered expression of specific isoforms.Hum Mol Genet. 2007 Dec 1;16(23):2880-91. doi: 10.1093/hmg/ddm247. Epub 2007 Sep 4.
• [5] Neurexin 3 transmembrane and soluble isoform expression and splicing haplotype are associated with neuron inflammasome and Alzheimer's disease.Alzheimers Res Ther. 2019 Mar 21;11(1):28. doi: 10.1186/s13195-019-0475-2.
• [6] Metabolic biomarkers and gallstone disease - a population-based study.Scand J Gastroenterol. 2017 Nov;52(11):1270-1277. doi: 10.1080/00365521.2017.1365166. Epub 2017 Aug 11.
• [7] Molecular analysis of cluster headache.Clin J Pain. 2015 Jan;31(1):52-7. doi: 10.1097/AJP.0000000000000075.
• [8] Genome wide association for addiction: replicated results and comparisons of two analytic approaches.PLoS One. 2010 Jan 21;5(1):e8832. doi: 10.1371/journal.pone.0008832.
• [9] Modeling a Neurexin-3 Human Mutation in Mouse Neurons Identifies a Novel Role in the Regulation of Transsynaptic Signaling and Neurotransmitter Release at Excitatory Synapses.J Neurosci. 2019 Nov 13;39(46):9065-9082. doi: 10.1523/JNEUROSCI.1261-19.2019. Epub 2019 Oct 2.
• [10] Genetic study of neurexin and neuroligin genes in Alzheimer's disease.J Alzheimers Dis. 2013;35(2):403-12. doi: 10.3233/JAD-122257.
• [11] FoxQ1 promotes glioma cells proliferation and migration by regulating NRXN3 expression.PLoS One. 2013;8(1):e55693. doi: 10.1371/journal.pone.0055693. Epub 2013 Jan 30.
• [12] Fine mapping of loci linked to autoimmune thyroid disease identifies novel susceptibility genes.J Clin Endocrinol Metab. 2013 Jan;98(1):E144-52. doi: 10.1210/jc.2012-2408. Epub 2012 Nov 1.
• [13] Association of neurexin 3 polymorphisms with smoking behavior.Genes Brain Behav. 2012 Aug;11(6):704-11. doi: 10.1111/j.1601-183X.2012.00815.x. Epub 2012 Jul 17.
• [14] Genome-wide association analyses identify 143 risk variants and putative regulatory mechanisms for type 2 diabetes.Nat Commun. 2018 Jul 27;9(1):2941. doi: 10.1038/s41467-018-04951-w.
• [15] Influence of genomic variation in FTO at 16q12.2, MC4R at 18q22 and NRXN3 at 14q31 genes on breast cancer risk.Mol Biol Rep. 2012 Mar;39(3):2915-9. doi: 10.1007/s11033-011-1053-2. Epub 2011 Jun 19.
• [16] The Role of YB1 in Renal Cell Carcinoma Cell Adhesion.Int J Med Sci. 2018 Aug 6;15(12):1304-1311. doi: 10.7150/ijms.25580. eCollection 2018.
• [17] Rare exonic deletions implicate the synaptic organizer Gephyrin (GPHN) in risk for autism, schizophrenia and seizures.Hum Mol Genet. 2013 May 15;22(10):2055-66. doi: 10.1093/hmg/ddt056. Epub 2013 Feb 7.
• [18] Exome capture sequencing of adenoma reveals genetic alterations in multiple cellular pathways at the early stage of colorectal tumorigenesis.PLoS One. 2013;8(1):e53310. doi: 10.1371/journal.pone.0053310. Epub 2013 Jan 2.
• [19] A rare exonic NRXN3 deletion segregating with neurodevelopmental and neuropsychiatric conditions in a three-generation Chinese family.Am J Med Genet B Neuropsychiatr Genet. 2018 Sep;177(6):589-595. doi: 10.1002/ajmg.b.32673. Epub 2018 Aug 4.
• [20] Transcriptional consequences of 16p11.2 deletion and duplication in mouse cortex and multiplex autism families.Am J Hum Genet. 2014 Jun 5;94(6):870-83. doi: 10.1016/j.ajhg.2014.05.004.
• [21] Autoantibodies to Synaptic Receptors and Neuronal Cell Surface Proteins in Autoimmune Diseases of the Central Nervous System.Physiol Rev. 2017 Apr;97(2):839-887. doi: 10.1152/physrev.00010.2016.
• [22] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [23] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [24] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [25] RNA sequence analysis of inducible pluripotent stem cell-derived cardiomyocytes reveals altered expression of DNA damage and cell cycle genes in response to doxorubicin. Toxicol Appl Pharmacol. 2018 Oct 1;356:44-53.
• [26] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [27] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [28] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [29] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [30] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [31] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [32] Endometrial receptivity is affected in women with high circulating progesterone levels at the end of the follicular phase: a functional genomics analysis. Hum Reprod. 2011 Jul;26(7):1813-25.
• [33] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [34] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [35] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [36] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [37] Global expression profiling of theophylline response genes in macrophages: evidence of airway anti-inflammatory regulation. Respir Res. 2005 Aug 8;6(1):89. doi: 10.1186/1465-9921-6-89.
• [38] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [39] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.