Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJ811IF)

• DOT Name: Serpin B9 (SERPINB9)
• Synonyms: Cytoplasmic antiproteinase 3; CAP-3; CAP3; Peptidase inhibitor 9; PI-9
• Gene Name: SERPINB9
• Related Disease:
  Breast cancer
  Breast carcinoma
  Amyloidosis
  Anaplastic large cell lymphoma
  Colorectal carcinoma
  Cytomegalovirus infection
  Interstitial nephritis
  Malignant soft tissue neoplasm
  Melanoma
  Neoplasm
  Sarcoma
  Tuberculosis
  Arteriosclerosis
  Atherosclerosis
  Bacterial infection
  Coronary atherosclerosis
  Cutaneous squamous cell carcinoma
  Skin cancer
• UniProt ID: SPB9_HUMAN
• PDB ID: 8H4X
• Pfam ID: PF00079
• Sequence:
  METLSNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSL
  NTEEDIHRAFQSLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELS
  FIRAAEESRKHINTWVSKKTEGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYT
  REMPFKINQEEQRPVQMMYQEATFKLAHVGEVRAQLLELPYARKELSLLVLLPDDGVELS
  TVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADL
  SAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFCADHPFLFFIR
  HNRANSILFCGRFSSP
• Function: Granzyme B inhibitor.
• KEGG Pathway: Amoebiasis (hsa05146)

Molecular Interaction Atlas (MIA) of This DOT

18 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Breast cancer	DIS7DPX1	Definitive	Biomarker	[1]
Breast carcinoma	DIS2UE88	Definitive	Biomarker	[1]
Amyloidosis	DISHTAI2	Strong	Altered Expression	[2]
Anaplastic large cell lymphoma	DISP4D1R	Strong	Altered Expression	[3]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[4]
Cytomegalovirus infection	DISCEMGC	Strong	Biomarker	[5]
Interstitial nephritis	DISKQGND	Strong	Biomarker	[6]
Malignant soft tissue neoplasm	DISTC6NO	Strong	Biomarker	[7]
Melanoma	DIS1RRCY	Strong	Altered Expression	[8]
Neoplasm	DISZKGEW	Strong	Biomarker	[9]
Sarcoma	DISZDG3U	Strong	Biomarker	[7]
Tuberculosis	DIS2YIMD	Disputed	Altered Expression	[10]
Arteriosclerosis	DISK5QGC	Limited	Altered Expression	[11]
Atherosclerosis	DISMN9J3	Limited	Altered Expression	[11]
Bacterial infection	DIS5QJ9S	Limited	Biomarker	[12]
Coronary atherosclerosis	DISKNDYU	Limited	Biomarker	[11]
Cutaneous squamous cell carcinoma	DIS3LXUG	Limited	Altered Expression	[13]
Skin cancer	DISTM18U	Limited	Biomarker	[13]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Serpin B9 (SERPINB9).	[14]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Serpin B9 (SERPINB9).	[34]

30 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Serpin B9 (SERPINB9).	[15]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Serpin B9 (SERPINB9).	[16]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Serpin B9 (SERPINB9).	[17]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Serpin B9 (SERPINB9).	[18]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Serpin B9 (SERPINB9).	[19]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Serpin B9 (SERPINB9).	[20]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Serpin B9 (SERPINB9).	[21]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Serpin B9 (SERPINB9).	[22]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Serpin B9 (SERPINB9).	[23]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Serpin B9 (SERPINB9).	[24]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Serpin B9 (SERPINB9).	[25]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Serpin B9 (SERPINB9).	[23]
Isotretinoin	DM4QTBN	Approved	Isotretinoin decreases the expression of Serpin B9 (SERPINB9).	[16]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of Serpin B9 (SERPINB9).	[26]
Ethanol	DMDRQZU	Approved	Ethanol decreases the expression of Serpin B9 (SERPINB9).	[27]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Serpin B9 (SERPINB9).	[28]
Menthol	DMG2KW7	Approved	Menthol increases the expression of Serpin B9 (SERPINB9).	[29]
Rifampicin	DM5DSFZ	Approved	Rifampicin increases the expression of Serpin B9 (SERPINB9).	[30]
Alitretinoin	DMME8LH	Approved	Alitretinoin decreases the expression of Serpin B9 (SERPINB9).	[16]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Serpin B9 (SERPINB9).	[31]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Serpin B9 (SERPINB9).	[23]
Belinostat	DM6OC53	Phase 2	Belinostat increases the expression of Serpin B9 (SERPINB9).	[23]
Afimoxifene	DMFORDT	Phase 2	Afimoxifene increases the expression of Serpin B9 (SERPINB9).	[32]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate increases the expression of Serpin B9 (SERPINB9).	[33]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Serpin B9 (SERPINB9).	[35]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Serpin B9 (SERPINB9).	[36]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Serpin B9 (SERPINB9).	[37]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Serpin B9 (SERPINB9).	[38]
Resorcinol	DMM37C0	Investigative	Resorcinol increases the expression of Serpin B9 (SERPINB9).	[39]
all-trans-4-oxo-retinoic acid	DMM2R1N	Investigative	all-trans-4-oxo-retinoic acid decreases the expression of Serpin B9 (SERPINB9).	[16]

References

• [1] The metastasis suppressor NME1 regulates expression of genes linked to metastasis and patient outcome in melanoma and breast carcinoma.Cancer Genomics Proteomics. 2014 Jul-Aug;11(4):175-94.
• [2] Sex-specific genetic predictors of Alzheimer's disease biomarkers.Acta Neuropathol. 2018 Dec;136(6):857-872. doi: 10.1007/s00401-018-1881-4. Epub 2018 Jul 2.
• [3] Expression levels of apoptosis-related proteins predict clinical outcome in anaplastic large cell lymphoma.Blood. 2002 Jun 15;99(12):4540-6. doi: 10.1182/blood.v99.12.4540.
• [4] Expression of Serpin B9 as a Prognostic Factor of Colorectal Cancer.Anticancer Res. 2019 Nov;39(11):6063-6066. doi: 10.21873/anticanres.13813.
• [5] The granzyme B inhibitor SERPINB9 (protease inhibitor 9) circulates in blood and increases on primary cytomegalovirus infection after renal transplantation.J Infect Dis. 2005 Dec 1;192(11):1908-11. doi: 10.1086/497606. Epub 2005 Oct 18.
• [6] SerpinB9 expression in human renal tubular epithelial cells is induced by triggering of the viral dsRNA sensors TLR3, MDA5 and RIG-I.Nephrol Dial Transplant. 2012 Jul;27(7):2746-54. doi: 10.1093/ndt/gfr690. Epub 2011 Dec 13.
• [7] Next generation sequencing analysis of miRNAs: MiR-127-3p inhibits glioblastoma proliferation and activates TGF- signaling by targeting SKI.OMICS. 2014 Mar;18(3):196-206. doi: 10.1089/omi.2013.0122. Epub 2014 Feb 11.
• [8] Expression of the apoptosis inhibitor protease inhibitor 9 predicts clinical outcome in vaccinated patients with stage III and IV melanoma.Clin Cancer Res. 2005 Sep 1;11(17):6400-7. doi: 10.1158/1078-0432.CCR-05-0306.
• [9] The Impact of Immune Interaction on the Metastatic Infiltration of Colorectal Carcinoma to Lymph Nodes.Anticancer Res. 2018 Jul;38(7):4159-4167. doi: 10.21873/anticanres.12709.
• [10] Role of protease inhibitor 9 in survival and replication of Mycobacterium tuberculosis in mononuclear phagocytes from HIV-1-infected patients.AIDS. 2014 Mar 13;28(5):679-87. doi: 10.1097/QAD.0000000000000192.
• [11] Peripheral leucocytes and tissue gene expression of granzyme B/perforin system and serpinB9: Impact on inflammation and insulin resistance in coronary atherosclerosis.Diabetes Res Clin Pract. 2017 Sep;131:132-141. doi: 10.1016/j.diabres.2017.07.013. Epub 2017 Jul 12.
• [12] Deciphering the Role of Intramolecular Networking in Cholic Acid-Peptide Conjugates on the Lipopolysaccharide Surface in Combating Gram-Negative Bacterial Infections.J Med Chem. 2019 Feb 28;62(4):1875-1886. doi: 10.1021/acs.jmedchem.8b01357. Epub 2019 Feb 11.
• [13] Disrupted regulation of serpinB9 in circulating T cells is associated with an increased risk for post-transplant skin cancer.Clin Exp Immunol. 2019 Sep;197(3):341-351. doi: 10.1111/cei.13309. Epub 2019 May 30.
• [14] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [15] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [16] Retinoic acid and its 4-oxo metabolites are functionally active in human skin cells in vitro. J Invest Dermatol. 2005 Jul;125(1):143-53.
• [17] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [18] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [19] Proteinase inhibitor 9, an inhibitor of granzyme B-mediated apoptosis, is a primary estrogen-inducible gene in human liver cells. J Biol Chem. 2000 Feb 25;275(8):5867-73. doi: 10.1074/jbc.275.8.5867.
• [20] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [21] Integrated assessment by multiple gene expression analysis of quercetin bioactivity on anticancer-related mechanisms in colon cancer cells in vitro. Eur J Nutr. 2005 Mar;44(3):143-56. doi: 10.1007/s00394-004-0503-1. Epub 2004 Apr 30.
• [22] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [23] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [24] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [25] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [26] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [27] Gene expression signatures after ethanol exposure in differentiating embryoid bodies. Toxicol In Vitro. 2018 Feb;46:66-76.
• [28] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [29] Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
• [30] Integrated analysis of rifampicin-induced microRNA and gene expression changes in human hepatocytes. Drug Metab Pharmacokinet. 2014;29(4):333-40.
• [31] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [32] Interplay between estrogen response element sequence and ligands controls in vivo binding of estrogen receptor to regulated genes. J Biol Chem. 2004 Feb 6;279(6):5025-34. doi: 10.1074/jbc.M307076200. Epub 2003 Nov 14.
• [33] Modulators of inflammation use nuclear factor-kappa B and activator protein-1 sites to induce the caspase-1 and granzyme B inhibitor, proteinase inhibitor 9. J Biol Chem. 2002 Oct 25;277(43):41230-9. doi: 10.1074/jbc.M200379200. Epub 2002 Aug 12.
• [34] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [35] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [36] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [37] Involvement of the Endocrine-Disrupting Chemical Bisphenol A (BPA) in Human Placentation. J Clin Med. 2020 Feb 3;9(2):405. doi: 10.3390/jcm9020405.
• [38] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [39] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.