Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJDUJPI)

• DOT Name: Cyclic AMP-responsive element-binding protein 5 (CREB5)
• Synonyms: CREB-5; cAMP-responsive element-binding protein 5; cAMP-response element-binding protein A; CRE-BPa
• Gene Name: CREB5
• Related Disease:
  Advanced cancer
  Atrial fibrillation
  Breast carcinoma
  Cholangiocarcinoma
  Colorectal carcinoma
  Epithelial ovarian cancer
  Hepatitis B virus infection
  Hepatocellular carcinoma
  Non-alcoholic fatty liver disease
  Prostate cancer
  Prostate carcinoma
  Prostate neoplasm
  Spontaneous abortion
  Thyroid gland carcinoma
  Urticaria
  Acute myelogenous leukaemia
  Familial atrial fibrillation
  Neoplasm
  Amyotrophic lateral sclerosis
• UniProt ID: CREB5_HUMAN
• Pfam ID: PF00170
• Sequence:
  MIYEESKMNLEQERPFVCSAPGCSQRFPTEDHLMIHRHKHEMTLKFPSIKTDNMLSDQTP
  TPTRFLKNCEEVGLFSELDCSLEHEFRKAQEEESSKRNISMHNAVGGAMTGPGTHQLSSA
  RLPNHDTNVVIQQAMPSPQSSSVITQAPSTNRQIGPVPGSLSSLLHLHNRQRQPMPASMP
  GTLPNPTMPGSSAVLMPMERQMSVNSSIMGMQGPNLSNPCASPQVQPMHSEAKMRLKAAL
  THHPAAMSNGNMNTMGHMMEMMGSRQDQTPHHHMHSHPHQHQTLPPHHPYPHQHQHPAHH
  PHPQPHHQQNHPHHHSHSHLHAHPAHHQTSPHPPLHTGNQAQVSPATQQMQPTQTIQPPQ
  PTGGRRRRVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNE
  VSMLKNEVAQLKQLLLTHKDCPITAMQKESQGYLSPESSPPASPVPACSQQQVIQHNTIT
  TSSSVSEVVGSSTLSQLTTHRTDLNPIL
• Function: Binds to the cAMP response element and activates transcription.
• KEGG Pathway:
  cGMP-PKG sig.ling pathway (hsa04022)
  cAMP sig.ling pathway (hsa04024)
  PI3K-Akt sig.ling pathway (hsa04151)
  AMPK sig.ling pathway (hsa04152)
  Longevity regulating pathway (hsa04211)
  Adrenergic sig.ling in cardiomyocytes (hsa04261)
  TNF sig.ling pathway (hsa04668)
  Thermogenesis (hsa04714)
  Cholinergic sy.pse (hsa04725)
  Dopaminergic sy.pse (hsa04728)
  Insulin secretion (hsa04911)
  Estrogen sig.ling pathway (hsa04915)
  Thyroid hormone synthesis (hsa04918)
  Glucagon sig.ling pathway (hsa04922)
  Aldosterone synthesis and secretion (hsa04925)
  Relaxin sig.ling pathway (hsa04926)
  Cortisol synthesis and secretion (hsa04927)
  Parathyroid hormone synthesis, secretion and action (hsa04928)
  Insulin resistance (hsa04931)
  Cushing syndrome (hsa04934)
  Growth hormone synthesis, secretion and action (hsa04935)
  Vasopressin-regulated water reabsorption (hsa04962)
  Huntington disease (hsa05016)
  Prion disease (hsa05020)
  Cocaine addiction (hsa05030)
  Amphetamine addiction (hsa05031)
  Alcoholism (hsa05034)
  Hepatitis B (hsa05161)
  Human cytomegalovirus infection (hsa05163)
  Human papillomavirus infection (hsa05165)
  Human T-cell leukemia virus 1 infection (hsa05166)
  Viral carcinogenesis (hsa05203)
  Chemical carcinogenesis - receptor activation (hsa05207)
  Prostate cancer (hsa05215)

Molecular Interaction Atlas (MIA) of This DOT

19 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[1]
Atrial fibrillation	DIS15W6U	Strong	Genetic Variation	[2]
Breast carcinoma	DIS2UE88	Strong	Genetic Variation	[3]
Cholangiocarcinoma	DIS71F6X	Strong	Biomarker	[4]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[5]
Epithelial ovarian cancer	DIS56MH2	Strong	Altered Expression	[1]
Hepatitis B virus infection	DISLQ2XY	Strong	Biomarker	[6]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[6]
Non-alcoholic fatty liver disease	DISDG1NL	Strong	Genetic Variation	[7]
Prostate cancer	DISF190Y	Strong	Biomarker	[8]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[8]
Prostate neoplasm	DISHDKGQ	Strong	Altered Expression	[9]
Spontaneous abortion	DISOWLOH	Strong	Biomarker	[10]
Thyroid gland carcinoma	DISMNGZ0	Strong	Biomarker	[4]
Urticaria	DIS9WQAI	Strong	Biomarker	[11]
Acute myelogenous leukaemia	DISCSPTN	moderate	Genetic Variation	[12]
Familial atrial fibrillation	DISL4AGF	moderate	Biomarker	[2]
Neoplasm	DISZKGEW	Disputed	Altered Expression	[13]
Amyotrophic lateral sclerosis	DISF7HVM	Limited	Altered Expression	[14]

25 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Cyclic AMP-responsive element-binding protein 5 (CREB5).	[15]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Cyclic AMP-responsive element-binding protein 5 (CREB5).	[16]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Cyclic AMP-responsive element-binding protein 5 (CREB5).	[17]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Cyclic AMP-responsive element-binding protein 5 (CREB5).	[18]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Cyclic AMP-responsive element-binding protein 5 (CREB5).	[19]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Cyclic AMP-responsive element-binding protein 5 (CREB5).	[20]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Cyclic AMP-responsive element-binding protein 5 (CREB5).	[21]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Cyclic AMP-responsive element-binding protein 5 (CREB5).	[22]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Cyclic AMP-responsive element-binding protein 5 (CREB5).	[23]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Cyclic AMP-responsive element-binding protein 5 (CREB5).	[24]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Cyclic AMP-responsive element-binding protein 5 (CREB5).	[25]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Cyclic AMP-responsive element-binding protein 5 (CREB5).	[26]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Cyclic AMP-responsive element-binding protein 5 (CREB5).	[27]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Cyclic AMP-responsive element-binding protein 5 (CREB5).	[28]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Cyclic AMP-responsive element-binding protein 5 (CREB5).	[29]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Cyclic AMP-responsive element-binding protein 5 (CREB5).	[30]
Azathioprine	DMMZSXQ	Approved	Azathioprine increases the expression of Cyclic AMP-responsive element-binding protein 5 (CREB5).	[31]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol increases the expression of Cyclic AMP-responsive element-binding protein 5 (CREB5).	[32]
Melphalan	DMOLNHF	Approved	Melphalan decreases the expression of Cyclic AMP-responsive element-binding protein 5 (CREB5).	[33]
Thalidomide	DM70BU5	Approved	Thalidomide decreases the expression of Cyclic AMP-responsive element-binding protein 5 (CREB5).	[34]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Cyclic AMP-responsive element-binding protein 5 (CREB5).	[35]
Genistein	DM0JETC	Phase 2/3	Genistein affects the expression of Cyclic AMP-responsive element-binding protein 5 (CREB5).	[36]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Cyclic AMP-responsive element-binding protein 5 (CREB5).	[39]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Cyclic AMP-responsive element-binding protein 5 (CREB5).	[40]
Glyphosate	DM0AFY7	Investigative	Glyphosate decreases the expression of Cyclic AMP-responsive element-binding protein 5 (CREB5).	[41]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Cyclic AMP-responsive element-binding protein 5 (CREB5).	[37]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the methylation of Cyclic AMP-responsive element-binding protein 5 (CREB5).	[38]

References

• [1] CREB5 promotes tumor cell invasion and correlates with poor prognosis in epithelial ovarian cancer.Oncol Lett. 2017 Dec;14(6):8156-8161. doi: 10.3892/ol.2017.7234. Epub 2017 Oct 20.
• [2] Multi-ethnic genome-wide association study for atrial fibrillation.Nat Genet. 2018 Jun 11;50(9):1225-1233. doi: 10.1038/s41588-018-0133-9.
• [3] Association analysis identifies 65 new breast cancer risk loci.Nature. 2017 Nov 2;551(7678):92-94. doi: 10.1038/nature24284. Epub 2017 Oct 23.
• [4] Anchored multiplex PCR for targeted next-generation sequencing.Nat Med. 2014 Dec;20(12):1479-84. doi: 10.1038/nm.3729. Epub 2014 Nov 10.
• [5] LncRNA SNHG5 affects cell proliferation, metastasis and migration of colorectal cancer through regulating miR-132-3p/CREB5.Cancer Biol Ther. 2019;20(4):524-536. doi: 10.1080/15384047.2018.1537579. Epub 2018 Nov 5.
• [6] Epigenetically regulated miR-449a enhances hepatitis B virus replication by targeting cAMP-responsive element binding protein 5 and modulating hepatocytes phenotype.Sci Rep. 2016 May 3;6:25389. doi: 10.1038/srep25389.
• [7] GWAS and enrichment analyses of non-alcoholic fatty liver disease identify new trait-associated genes and pathways across eMERGE Network.BMC Med. 2019 Jul 17;17(1):135. doi: 10.1186/s12916-019-1364-z.
• [8] CREB5 Promotes Resistance to Androgen-Receptor Antagonists and Androgen Deprivation in Prostate Cancer.Cell Rep. 2019 Nov 19;29(8):2355-2370.e6. doi: 10.1016/j.celrep.2019.10.068.
• [9] An infectious retrovirus susceptible to an IFN antiviral pathway from human prostate tumors.Proc Natl Acad Sci U S A. 2007 Jan 30;104(5):1655-60. doi: 10.1073/pnas.0610291104. Epub 2007 Jan 18.
• [10] Integrated analysis of DNA methylome and transcriptome identified CREB5 as a novel risk gene contributing to recurrent pregnancy loss.EBioMedicine. 2018 Sep;35:334-344. doi: 10.1016/j.ebiom.2018.07.042. Epub 2018 Aug 10.
• [11] CREB5 computational regulation network construction and analysis between frontal cortex of HIV encephalitis (HIVE) and HIVE-control patients.Cell Biochem Biophys. 2011 Jul;60(3):199-207. doi: 10.1007/s12013-010-9140-x.
• [12] Genome-wide haplotype association study identify the FGFR2 gene as a risk gene for acute myeloid leukemia.Oncotarget. 2017 Jan 31;8(5):7891-7899. doi: 10.18632/oncotarget.13631.
• [13] Regulation of miRNA-29c and its downstream pathways in preneoplastic progression of triple-negative breast cancer.Oncotarget. 2017 Mar 21;8(12):19645-19660. doi: 10.18632/oncotarget.14902.
• [14] ALS blood expression profiling identifies new biomarkers, patient subgroups, and evidence for neutrophilia and hypoxia.J Transl Med. 2019 May 22;17(1):170. doi: 10.1186/s12967-019-1909-0.
• [15] Design principles of concentration-dependent transcriptome deviations in drug-exposed differentiating stem cells. Chem Res Toxicol. 2014 Mar 17;27(3):408-20.
• [16] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [17] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [18] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [19] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [20] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [21] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [22] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [23] Arsenic suppresses gene expression in promyelocytic leukemia cells partly through Sp1 oxidation. Blood. 2005 Jul 1;106(1):304-10.
• [24] Oxidative stress modulates theophylline effects on steroid responsiveness. Biochem Biophys Res Commun. 2008 Dec 19;377(3):797-802.
• [25] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [26] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [27] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [28] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [29] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [30] Effects of progesterone treatment on expression of genes involved in uterine quiescence. Reprod Sci. 2011 Aug;18(8):781-97.
• [31] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [32] The genomic response of a human uterine endometrial adenocarcinoma cell line to 17alpha-ethynyl estradiol. Toxicol Sci. 2009 Jan;107(1):40-55.
• [33] Bone marrow osteoblast damage by chemotherapeutic agents. PLoS One. 2012;7(2):e30758. doi: 10.1371/journal.pone.0030758. Epub 2012 Feb 17.
• [34] Early Transcriptomic Changes upon Thalidomide Exposure Influence the Later Neuronal Development in Human Embryonic Stem Cell-Derived Spheres. Int J Mol Sci. 2020 Aug 3;21(15):5564. doi: 10.3390/ijms21155564.
• [35] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [36] Dose- and time-dependent transcriptional response of Ishikawa cells exposed to genistein. Toxicol Sci. 2016 May;151(1):71-87.
• [37] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [38] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [39] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [40] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [41] Glyphosate-based herbicides at low doses affect canonical pathways in estrogen positive and negative breast cancer cell lines. PLoS One. 2019 Jul 11;14(7):e0219610. doi: 10.1371/journal.pone.0219610. eCollection 2019.