Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJEUB6U)

• DOT Name: Ectoderm-neural cortex protein 1 (ENC1)
• Synonyms: ENC-1; Kelch-like protein 37; Nuclear matrix protein NRP/B; p53-induced gene 10 protein
• Gene Name: ENC1
• Related Disease:
  Adenoma
  Adult hepatocellular carcinoma
  Advanced cancer
  Brain neoplasm
  Breast neoplasm
  Depression
  Hepatocellular carcinoma
  Liver cancer
  Neoplasm
  Nervous system neoplasm
  Neuroblastoma
  Plasma cell myeloma
  Primary myelofibrosis
  Pulmonary fibrosis
  Adrenal adenoma
  Colorectal carcinoma
  Hairy cell leukaemia
• UniProt ID: ENC1_HUMAN
• Pfam ID: PF07707 ; PF00651 ; PF01344
• Sequence:
  MSVSVHENRKSRASSGSINIYLFHKSSYADSVLTHLNLLRQQRLFTDVLLHAGNRTFPCH
  RAVLAACSRYFEAMFSGGLKESQDSEVNFDNSIHPEVLELLLDYAYSSRVIINEENAESL
  LEAGDMLEFQDIRDACAEFLEKNLHPTNCLGMLLLSDAHQCTKLYELSWRMCLSNFQTIR
  KNEDFLQLPQDMVVQLLSSEELETEDERLVYESAINWISYDLKKRYCYLPELLQTVRLAL
  LPAIYLMENVAMEELITKQRKSKEIVEEAIRCKLKILQNDGVVTSLCARPRKTGHALFLL
  GGQTFMCDKLYLVDQKAKEIIPKADIPSPRKEFSACAIGCKVYITGGRGSENGVSKDVWV
  YDTLHEEWSKAAPMLVARFGHGSAELKHCLYVVGGHTAATGCLPASPSVSLKQVEHYDPT
  INKWTMVAPLREGVSNAAVVSAKLKLFAFGGTSVSHDKLPKVQCYDQCENRWTVPATCPQ
  PWRYTAAAVLGNQIFIMGGDTEFSACSAYKFNSETYQWTKVGDVTAKRMSCHAVASGNKL
  YVVGGYFGIQRCKTLDCYDPTLDVWNSITTVPYSLIPTAFVSTWKHLPS
• Function: Actin-binding protein involved in the regulation of neuronal process formation and in differentiation of neural crest cells. Down-regulates transcription factor NF2L2/NRF2 by decreasing the rate of protein synthesis and not via a ubiquitin-mediated proteasomal degradation mechanism.
• Tissue Specificity: Detected in fetal brain tissue, moderate expression in fetal heart, lung and kidney. Highly expressed in adult brain, particularly high in the hippocampus and amygdala, and spinal chord. Detectable in adult pancreas. May be down-regulated in neuroblastoma tumors.

Molecular Interaction Atlas (MIA) of This DOT

17 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adenoma	DIS78ZEV	Strong	Biomarker	[1]
Adult hepatocellular carcinoma	DIS6ZPAI	Strong	Biomarker	[2]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[2]
Brain neoplasm	DISY3EKS	Strong	Genetic Variation	[3]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[4]
Depression	DIS3XJ69	Strong	Biomarker	[5]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[2]
Liver cancer	DISDE4BI	Strong	Biomarker	[2]
Neoplasm	DISZKGEW	Strong	Altered Expression	[1]
Nervous system neoplasm	DIS141UP	Strong	Altered Expression	[6]
Neuroblastoma	DISVZBI4	Strong	Altered Expression	[6]
Plasma cell myeloma	DIS0DFZ0	Strong	Altered Expression	[7]
Primary myelofibrosis	DIS6L0CN	Strong	Biomarker	[8]
Pulmonary fibrosis	DISQKVLA	Strong	Altered Expression	[8]
Adrenal adenoma	DISC2UN8	Limited	Altered Expression	[9]
Colorectal carcinoma	DIS5PYL0	Limited	Biomarker	[10]
Hairy cell leukaemia	DISTD2E5	Limited	Biomarker	[11]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Mitoxantrone	DMM39BF	Approved	Ectoderm-neural cortex protein 1 (ENC1) affects the response to substance of Mitoxantrone.	[43]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Ectoderm-neural cortex protein 1 (ENC1).	[12]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Ectoderm-neural cortex protein 1 (ENC1).	[33]

31 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Ectoderm-neural cortex protein 1 (ENC1).	[13]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Ectoderm-neural cortex protein 1 (ENC1).	[14]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Ectoderm-neural cortex protein 1 (ENC1).	[15]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Ectoderm-neural cortex protein 1 (ENC1).	[16]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Ectoderm-neural cortex protein 1 (ENC1).	[17]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Ectoderm-neural cortex protein 1 (ENC1).	[18]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Ectoderm-neural cortex protein 1 (ENC1).	[19]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Ectoderm-neural cortex protein 1 (ENC1).	[20]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Ectoderm-neural cortex protein 1 (ENC1).	[21]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Ectoderm-neural cortex protein 1 (ENC1).	[22]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Ectoderm-neural cortex protein 1 (ENC1).	[23]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Ectoderm-neural cortex protein 1 (ENC1).	[24]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol decreases the expression of Ectoderm-neural cortex protein 1 (ENC1).	[25]
Obeticholic acid	DM3Q1SM	Approved	Obeticholic acid increases the expression of Ectoderm-neural cortex protein 1 (ENC1).	[26]
Mifepristone	DMGZQEF	Approved	Mifepristone increases the expression of Ectoderm-neural cortex protein 1 (ENC1).	[27]
Colchicine	DM2POTE	Approved	Colchicine decreases the expression of Ectoderm-neural cortex protein 1 (ENC1).	[28]
Nefazodone	DM4ZS8M	Approved	Nefazodone decreases the expression of Ectoderm-neural cortex protein 1 (ENC1).	[29]
Adenine	DMZLHKJ	Approved	Adenine decreases the expression of Ectoderm-neural cortex protein 1 (ENC1).	[28]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone decreases the expression of Ectoderm-neural cortex protein 1 (ENC1).	[30]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Ectoderm-neural cortex protein 1 (ENC1).	[31]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Ectoderm-neural cortex protein 1 (ENC1).	[32]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Ectoderm-neural cortex protein 1 (ENC1).	[34]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Ectoderm-neural cortex protein 1 (ENC1).	[35]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Ectoderm-neural cortex protein 1 (ENC1).	[36]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Ectoderm-neural cortex protein 1 (ENC1).	[37]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Ectoderm-neural cortex protein 1 (ENC1).	[30]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Ectoderm-neural cortex protein 1 (ENC1).	[38]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Ectoderm-neural cortex protein 1 (ENC1).	[39]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Ectoderm-neural cortex protein 1 (ENC1).	[40]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of Ectoderm-neural cortex protein 1 (ENC1).	[41]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Ectoderm-neural cortex protein 1 (ENC1).	[42]

References

• [1] Identification of a subtype-specific ENC1 gene related to invasiveness in human pituitary null cell adenoma and oncocytomas.J Neurooncol. 2014 Sep;119(2):307-15. doi: 10.1007/s11060-014-1479-1. Epub 2014 Jun 11.
• [2] Comprehensive study of tumour single nucleotide polymorphism array data reveals significant driver aberrations and disrupted signalling pathways in human hepatocellular cancer.IET Syst Biol. 2014 Apr;8(2):24-32. doi: 10.1049/iet-syb.2013.0027.
• [3] NRP/B mutations impair Nrf2-dependent NQO1 induction in human primary brain tumors.Oncogene. 2009 Jan 22;28(3):378-89. doi: 10.1038/onc.2008.396. Epub 2008 Nov 3.
• [4] The nuclear matrix protein, NRP/B, enhances Nrf2-mediated oxidative stress responses in breast cancer cells.Cancer Res. 2007 Sep 15;67(18):8596-604. doi: 10.1158/0008-5472.CAN-06-3785.
• [5] Identification of genes associated with dissociation of cognitive performance and neuropathological burden: Multistep analysis of genetic, epigenetic, and transcriptional data.PLoS Med. 2017 Apr 25;14(4):e1002287. doi: 10.1371/journal.pmed.1002287. eCollection 2017 Apr.
• [6] Cloning of human ENC-1 and evaluation of its expression and regulation in nervous system tumors.Exp Cell Res. 1998 Aug 1;242(2):470-7. doi: 10.1006/excr.1998.4109.
• [7] A possible role for the loss of CD27-CD70 interaction in myelomagenesis.Br J Haematol. 2003 Jan;120(2):223-34. doi: 10.1046/j.1365-2141.2003.04069.x.
• [8] Shared and Tissue-Specific Expression Signatures between Bone Marrow from Primary Myelofibrosis and Essential Thrombocythemia.Exp Hematol. 2019 Nov;79:16-25.e3. doi: 10.1016/j.exphem.2019.10.001. Epub 2019 Nov 1.
• [9] Characterization of differential gene expression in adrenocortical tumors harboring beta-catenin (CTNNB1) mutations.J Clin Endocrinol Metab. 2011 Jul;96(7):E1206-11. doi: 10.1210/jc.2010-2143. Epub 2011 May 11.
• [10] Up-regulation of the ectodermal-neural cortex 1 (ENC1) gene, a downstream target of the beta-catenin/T-cell factor complex, in colorectal carcinomas.Cancer Res. 2001 Nov 1;61(21):7722-6.
• [11] Disruption of a novel ectodermal neural cortex 1 antisense gene, ENC-1AS and identification of ENC-1 overexpression in hairy cell leukemia.Hum Mol Genet. 2004 Dec 1;13(23):2925-36. doi: 10.1093/hmg/ddh315. Epub 2004 Sep 30.
• [12] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [13] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [14] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [15] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [16] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [17] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [18] Research resource: STR DNA profile and gene expression comparisons of human BG-1 cells and a BG-1/MCF-7 clonal variant. Mol Endocrinol. 2014 Dec;28(12):2072-81.
• [19] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [20] Chronic occupational exposure to arsenic induces carcinogenic gene signaling networks and neoplastic transformation in human lung epithelial cells. Toxicol Appl Pharmacol. 2012 Jun 1;261(2):204-16.
• [21] Unique signatures of stress-induced senescent human astrocytes. Exp Neurol. 2020 Dec;334:113466. doi: 10.1016/j.expneurol.2020.113466. Epub 2020 Sep 17.
• [22] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [23] Progesterone regulation of implantation-related genes: new insights into the role of oestrogen. Cell Mol Life Sci. 2007 Apr;64(7-8):1009-32.
• [24] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [25] The genomic response of a human uterine endometrial adenocarcinoma cell line to 17alpha-ethynyl estradiol. Toxicol Sci. 2009 Jan;107(1):40-55.
• [26] Pharmacotoxicology of clinically-relevant concentrations of obeticholic acid in an organotypic human hepatocyte system. Toxicol In Vitro. 2017 Mar;39:93-103.
• [27] Mifepristone induced progesterone withdrawal reveals novel regulatory pathways in human endometrium. Mol Hum Reprod. 2007 Sep;13(9):641-54.
• [28] Utilization of CDKN1A/p21 gene for class discrimination of DNA damage-induced clastogenicity. Toxicology. 2014 Jan 6;315:8-16. doi: 10.1016/j.tox.2013.10.009. Epub 2013 Nov 6.
• [29] Robustness testing and optimization of an adverse outcome pathway on cholestatic liver injury. Arch Toxicol. 2020 Apr;94(4):1151-1172. doi: 10.1007/s00204-020-02691-9. Epub 2020 Mar 10.
• [30] Unique bisphenol A transcriptome in prostate cancer: novel effects on ERbeta expression that correspond to androgen receptor mutation status. Environ Health Perspect. 2007 Nov;115(11):1646-53. doi: 10.1289/ehp.10283.
• [31] Interactive gene expression pattern in prostate cancer cells exposed to phenolic antioxidants. Life Sci. 2002 Mar 1;70(15):1821-39.
• [32] A high concentration of genistein down-regulates activin A, Smad3 and other TGF-beta pathway genes in human uterine leiomyoma cells. Exp Mol Med. 2012 Apr 30;44(4):281-92.
• [33] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [34] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [35] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [36] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [37] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [38] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [39] Regulation of chromatin assembly and cell transformation by formaldehyde exposure in human cells. Environ Health Perspect. 2017 Sep 21;125(9):097019.
• [40] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [41] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [42] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [43] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.