Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTKDZU0D)

• DOT Name: Nucleolar and coiled-body phosphoprotein 1 (NOLC1)
• Synonyms: 140 kDa nucleolar phosphoprotein; Nopp140; Hepatitis C virus NS5A-transactivated protein 13; HCV NS5A-transactivated protein 13; Nucleolar 130 kDa protein; Nucleolar phosphoprotein p130
• Gene Name: NOLC1
• Related Disease:
  Advanced cancer
  Retinoblastoma
  Alzheimer disease
  Breast carcinoma
  Carcinoma
  Hepatocellular carcinoma
  Herpes simplex infection
  Intellectual disability
  Lung adenocarcinoma
  Martsolf syndrome
  Nasopharyngeal carcinoma
  Neoplasm
  Non-small-cell lung cancer
  Precancerous condition
  Small-cell lung cancer
  Squamous cell carcinoma
  Warburg micro syndrome 1
  Treacher-Collins syndrome
  Prostate cancer
  Prostate carcinoma
  Carcinoma of liver and intrahepatic biliary tract
  Colorectal carcinoma
  Epithelial ovarian cancer
  Liver cancer
  Melanoma
  Ovarian cancer
• UniProt ID: NOLC1_HUMAN
• Pfam ID: PF05022
• Sequence:
  MADAGIRRVVPSDLYPLVLGFLRDNQLSEVANKFAKATGATQQDANASSLLDIYSFWLKS
  AKVPERKLQANGPVAKKAKKKASSSDSEDSSEEEEEVQGPPAKKAAVPAKRVGLPPGKAA
  AKASESSSSEESSDDDDEEDQKKQPVQKGVKPQAKAAKAPPKKAKSSDSDSDSSSEDEPP
  KNQKPKITPVTVKAQTKAPPKPARAAPKIANGKAASSSSSSSSSSSSDDSEEEKAAATPK
  KTVPKKQVVAKAPVKAATTPTRKSSSSEDSSSDEEEEQKKPMKNKPGPYSSVPPPSAPPP
  KKSLGTQPPKKAVEKQQPVESSEDSSDESDSSSEEEKKPPTKAVVSKATTKPPPAKKAAE
  SSSDSSDSDSSEDDEAPSKPAGTTKNSSNKPAVTTKSPAVKPAAAPKQPVGGGQKLLTRK
  ADSSSSEEESSSSEEEKTKKMVATTKPKATAKAALSLPAKQAPQGSRDSSSDSDSSSSEE
  EEEKTSKSAVKKKPQKVAGGAAPSKPASAKKGKAESSNSSSSDDSSEEEEEKLKGKGSPR
  PQAPKANGTSALTAQNGKAAKNSEEEEEEKKKAAVVVSKSGSLKKRKQNEAAKEAETPQA
  KKIKLQTPNTFPKRKKGEKRASSPFRRVREEEIEVDSRVADNSFDAKRGAAGDWGERANQ
  VLKFTKGKSFRHEKTKKKRGSYRGGSISVQVNSIKFDSE
• Function: Nucleolar protein that acts as a regulator of RNA polymerase I by connecting RNA polymerase I with enzymes responsible for ribosomal processing and modification. Required for neural crest specification: following monoubiquitination by the BCR(KBTBD8) complex, associates with TCOF1 and acts as a platform to connect RNA polymerase I with enzymes responsible for ribosomal processing and modification, leading to remodel the translational program of differentiating cells in favor of neural crest specification. Involved in nucleologenesis, possibly by playing a role in the maintenance of the fundamental structure of the fibrillar center and dense fibrillar component in the nucleolus. It has intrinsic GTPase and ATPase activities.

Molecular Interaction Atlas (MIA) of This DOT

26 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Definitive	Biomarker	[1]
Retinoblastoma	DISVPNPB	Definitive	Altered Expression	[2]
Alzheimer disease	DISF8S70	Strong	Biomarker	[3]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[4]
Carcinoma	DISH9F1N	Strong	Biomarker	[5]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[6]
Herpes simplex infection	DISL1SAV	Strong	Biomarker	[7]
Intellectual disability	DISMBNXP	Strong	Genetic Variation	[8]
Lung adenocarcinoma	DISD51WR	Strong	Biomarker	[9]
Martsolf syndrome	DISF77WN	Strong	Genetic Variation	[8]
Nasopharyngeal carcinoma	DISAOTQ0	Strong	Biomarker	[10]
Neoplasm	DISZKGEW	Strong	Biomarker	[11]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[12]
Precancerous condition	DISV06FL	Strong	Altered Expression	[2]
Small-cell lung cancer	DISK3LZD	Strong	Biomarker	[13]
Squamous cell carcinoma	DISQVIFL	Strong	Altered Expression	[5]
Warburg micro syndrome 1	DIS90EI2	Strong	Genetic Variation	[8]
Treacher-Collins syndrome	DIS2GXZ1	moderate	Genetic Variation	[14]
Prostate cancer	DISF190Y	Disputed	Biomarker	[15]
Prostate carcinoma	DISMJPLE	Disputed	Biomarker	[15]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Limited	Biomarker	[10]
Colorectal carcinoma	DIS5PYL0	Limited	Biomarker	[16]
Epithelial ovarian cancer	DIS56MH2	Limited	Biomarker	[17]
Liver cancer	DISDE4BI	Limited	Biomarker	[10]
Melanoma	DIS1RRCY	Limited	Genetic Variation	[18]
Ovarian cancer	DISZJHAP	Limited	Biomarker	[17]

5 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Nucleolar and coiled-body phosphoprotein 1 (NOLC1).	[19]
TAK-243	DM4GKV2	Phase 1	TAK-243 decreases the sumoylation of Nucleolar and coiled-body phosphoprotein 1 (NOLC1).	[37]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Nucleolar and coiled-body phosphoprotein 1 (NOLC1).	[39]
Coumarin	DM0N8ZM	Investigative	Coumarin affects the phosphorylation of Nucleolar and coiled-body phosphoprotein 1 (NOLC1).	[39]
Hexadecanoic acid	DMWUXDZ	Investigative	Hexadecanoic acid increases the phosphorylation of Nucleolar and coiled-body phosphoprotein 1 (NOLC1).	[44]

22 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Nucleolar and coiled-body phosphoprotein 1 (NOLC1).	[20]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Nucleolar and coiled-body phosphoprotein 1 (NOLC1).	[21]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Nucleolar and coiled-body phosphoprotein 1 (NOLC1).	[22]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Nucleolar and coiled-body phosphoprotein 1 (NOLC1).	[23]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Nucleolar and coiled-body phosphoprotein 1 (NOLC1).	[24]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Nucleolar and coiled-body phosphoprotein 1 (NOLC1).	[25]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Nucleolar and coiled-body phosphoprotein 1 (NOLC1).	[26]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Nucleolar and coiled-body phosphoprotein 1 (NOLC1).	[27]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Nucleolar and coiled-body phosphoprotein 1 (NOLC1).	[28]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Nucleolar and coiled-body phosphoprotein 1 (NOLC1).	[28]
Piroxicam	DMTK234	Approved	Piroxicam increases the expression of Nucleolar and coiled-body phosphoprotein 1 (NOLC1).	[29]
Sodium phenylbutyrate	DMXLBCQ	Approved	Sodium phenylbutyrate decreases the expression of Nucleolar and coiled-body phosphoprotein 1 (NOLC1).	[30]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of Nucleolar and coiled-body phosphoprotein 1 (NOLC1).	[31]
GSK2110183	DMZHB37	Phase 2	GSK2110183 decreases the expression of Nucleolar and coiled-body phosphoprotein 1 (NOLC1).	[33]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate increases the expression of Nucleolar and coiled-body phosphoprotein 1 (NOLC1).	[34]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Nucleolar and coiled-body phosphoprotein 1 (NOLC1).	[35]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Nucleolar and coiled-body phosphoprotein 1 (NOLC1).	[36]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Nucleolar and coiled-body phosphoprotein 1 (NOLC1).	[38]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Nucleolar and coiled-body phosphoprotein 1 (NOLC1).	[40]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Nucleolar and coiled-body phosphoprotein 1 (NOLC1).	[41]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Nucleolar and coiled-body phosphoprotein 1 (NOLC1).	[42]
Deguelin	DMXT7WG	Investigative	Deguelin decreases the expression of Nucleolar and coiled-body phosphoprotein 1 (NOLC1).	[43]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
DNCB	DMDTVYC	Phase 2	DNCB affects the binding of Nucleolar and coiled-body phosphoprotein 1 (NOLC1).	[32]

References

• [1] The specific role of pRb in p16 (INK4A) -mediated arrest of normal and malignant human breast cells.Cell Cycle. 2012 Mar 1;11(5):1008-13. doi: 10.4161/cc.11.5.19492. Epub 2012 Mar 1.
• [2] Developmental stage-specific proliferation and retinoblastoma genesis in RB-deficient human but not mouse cone precursors.Proc Natl Acad Sci U S A. 2018 Oct 2;115(40):E9391-E9400. doi: 10.1073/pnas.1808903115. Epub 2018 Sep 13.
• [3] Increased expression of p130 in Alzheimer disease.Neurochem Res. 2007 Apr-May;32(4-5):639-44. doi: 10.1007/s11064-006-9146-3. Epub 2006 Sep 28.
• [4] Expression of Rb2/p130 in breast and endometrial cancer: correlations with hormone receptor status.Br J Cancer. 2001 Aug 17;85(4):546-51. doi: 10.1054/bjoc.2001.1923.
• [5] Immunohistochemical investigation of new suppressor oncogene p130 in oral squamous cell carcinoma.Oral Oncol. 1999 May;35(3):321-5. doi: 10.1016/s1368-8375(98)00089-x.
• [6] Enhanced NOLC1 promotes cell senescence and represses hepatocellular carcinoma cell proliferation by disturbing the organization of nucleolus.Aging Cell. 2017 Aug;16(4):726-737. doi: 10.1111/acel.12602. Epub 2017 May 10.
• [7] The human cytomegalovirus glycoprotein B gene (ORF UL55) is expressed early in the infectious cycle.J Gen Virol. 1997 Aug;78 ( Pt 8):1981-92. doi: 10.1099/0022-1317-78-8-1981.
• [8] Analysis on the emerging role of Rab3 GTPase-activating protein in Warburg Micro and Martsolf syndrome.Methods Enzymol. 2008;438:131-9. doi: 10.1016/S0076-6879(07)38009-9.
• [9] Reduced angiomotin p130 expression correlates with poor prognosis in lung adenocarcinoma.J Clin Pathol. 2017 Jul;70(7):625-630. doi: 10.1136/jclinpath-2016-204071. Epub 2016 Dec 15.
• [10] Methylation of nucleolar and coiled-body phosphoprotein1 is associated with the mechanism of tumorigenesis in hepatocellular carcinoma.Oncol Rep. 2013 Nov;30(5):2220-8. doi: 10.3892/or.2013.2676. Epub 2013 Aug 20.
• [11] Ablating all three retinoblastoma family members in mouse lung leads to neuroendocrine tumor formation.Oncotarget. 2017 Jan 17;8(3):4373-4386. doi: 10.18632/oncotarget.13875.
• [12] Identification and validation of NOLC1 as a potential target for enhancing sensitivity in multidrug resistant non-small cell lung cancer cells.Cell Mol Biol Lett. 2018 Nov 27;23:54. doi: 10.1186/s11658-018-0119-8. eCollection 2018.
• [13] Loss of p130 accelerates tumor development in a mouse model for human small-cell lung carcinoma.Cancer Res. 2010 May 15;70(10):3877-83. doi: 10.1158/0008-5472.CAN-09-4228. Epub 2010 Apr 20.
• [14] Cell-fate determination by ubiquitin-dependent regulation of translation.Nature. 2015 Sep 24;525(7570):523-7. doi: 10.1038/nature14978.
• [15] Microbubble-assisted p53, RB, and p130 gene transfer in combination with radiation therapy in prostate cancer.Curr Gene Ther. 2013 Jun 1;13(3):163-74. doi: 10.2174/1566523211313030001.
• [16] Functional screening identifies miRNAs influencing apoptosis and proliferation in colorectal cancer.PLoS One. 2014 Jun 3;9(6):e96767. doi: 10.1371/journal.pone.0096767. eCollection 2014.
• [17] miR-106a represses the Rb tumor suppressor p130 to regulate cellular proliferation and differentiation in high-grade serous ovarian carcinoma.Mol Cancer Res. 2013 Nov;11(11):1314-25. doi: 10.1158/1541-7786.MCR-13-0131. Epub 2013 Sep 17.
• [18] Melanocyte transformation requires complete loss of all pocket protein function via a mechanism that mitigates the need for MAPK pathway activation.Oncogene. 2017 Jun 29;36(26):3789-3795. doi: 10.1038/onc.2016.511. Epub 2017 Feb 13.
• [19] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [20] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [21] Retinoic acid-induced downmodulation of telomerase activity in human cancer cells. Exp Mol Pathol. 2005 Oct;79(2):108-17.
• [22] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [23] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [24] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [25] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [26] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [27] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [28] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [29] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [30] Gene expression profile analysis of 4-phenylbutyrate treatment of IB3-1 bronchial epithelial cell line demonstrates a major influence on heat-shock proteins. Physiol Genomics. 2004 Jan 15;16(2):204-11.
• [31] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [32] Proteomic analysis of the cellular response to a potent sensitiser unveils the dynamics of haptenation in living cells. Toxicology. 2020 Dec 1;445:152603. doi: 10.1016/j.tox.2020.152603. Epub 2020 Sep 28.
• [33] Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
• [34] Comparison of gene expression profiles in HepG2 cells exposed to arsenic, cadmium, nickel, and three model carcinogens for investigating the mechanisms of metal carcinogenesis. Environ Mol Mutagen. 2009 Jan;50(1):46-59.
• [35] New insights into BaP-induced toxicity: role of major metabolites in transcriptomics and contribution to hepatocarcinogenesis. Arch Toxicol. 2016 Jun;90(6):1449-58.
• [36] BET bromodomain inhibition targets both c-Myc and IL7R in high-risk acute lymphoblastic leukemia. Blood. 2012 Oct 4;120(14):2843-52.
• [37] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [38] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [39] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [40] DON shares a similar mode of action as the ribotoxic stress inducer anisomycin while TBTO shares ER stress patterns with the ER stress inducer thapsigargin based on comparative gene expression profiling in Jurkat T cells. Toxicol Lett. 2014 Jan 30;224(3):395-406. doi: 10.1016/j.toxlet.2013.11.005. Epub 2013 Nov 15.
• [41] Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.
• [42] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [43] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [44] Functional lipidomics: Palmitic acid impairs hepatocellular carcinoma development by modulating membrane fluidity and glucose metabolism. Hepatology. 2017 Aug;66(2):432-448. doi: 10.1002/hep.29033. Epub 2017 Jun 16.