Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTKHOD17)

DOT Name Homeobox protein Hox-B8 (HOXB8)
Synonyms Homeobox protein Hox-2.4; Homeobox protein Hox-2D
Gene Name HOXB8
Related Disease
Acute lymphocytic leukaemia ( )
Adult glioblastoma ( )
Advanced cancer ( )
Autism spectrum disorder ( )
Bone osteosarcoma ( )
Breast cancer ( )
Breast carcinoma ( )
Campomelic dysplasia ( )
Cervical cancer ( )
Cervical carcinoma ( )
Colorectal carcinoma ( )
Cyclic hematopoiesis ( )
Glioblastoma multiforme ( )
leukaemia ( )
Leukemia ( )
Neuroblastoma ( )
Obsessive compulsive disorder ( )
Osteosarcoma ( )
Renal carcinoma ( )
Renal cell carcinoma ( )
Severe congenital neutropenia ( )
Trichotillomania ( )
Alopecia ( )
Anxiety ( )
Anxiety disorder ( )
Pancreatic cancer ( )
Acute myelogenous leukaemia ( )
Metastatic malignant neoplasm ( )
Stomach cancer ( )
UniProt ID
HXB8_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00046
Sequence
MSSYFVNSLFSKYKTGESLRPNYYDCGFAQDLGGRPTVVYGPSSGGSFQHPSQIQEFYHG
PSSLSTAPYQQNPCAVACHGDPGNFYGYDPLQRQSLFGAQDPDLVQYADCKLAAASGLGE
EAEGSEQSPSPTQLFPWMRPQAAAGRRRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVS
HALGLTERQVKIWFQNRRMKWKKENNKDKFPSSKCEQEELEKQKLERAPEAADEGDAQKG
DKK
Function Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.

Molecular Interaction Atlas (MIA) of This DOT

29 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Acute lymphocytic leukaemia DISPX75S Strong Biomarker [1]
Adult glioblastoma DISVP4LU Strong Biomarker [2]
Advanced cancer DISAT1Z9 Strong Altered Expression [3]
Autism spectrum disorder DISXK8NV Strong Biomarker [4]
Bone osteosarcoma DIST1004 Strong Biomarker [5]
Breast cancer DIS7DPX1 Strong Biomarker [6]
Breast carcinoma DIS2UE88 Strong Biomarker [6]
Campomelic dysplasia DISVTW53 Strong Biomarker [7]
Cervical cancer DISFSHPF Strong Altered Expression [8]
Cervical carcinoma DIST4S00 Strong Altered Expression [8]
Colorectal carcinoma DIS5PYL0 Strong Biomarker [9]
Cyclic hematopoiesis DISQQOM4 Strong Genetic Variation [10]
Glioblastoma multiforme DISK8246 Strong Biomarker [2]
leukaemia DISS7D1V Strong Altered Expression [1]
Leukemia DISNAKFL Strong Altered Expression [1]
Neuroblastoma DISVZBI4 Strong Altered Expression [11]
Obsessive compulsive disorder DIS1ZMM2 Strong Biomarker [4]
Osteosarcoma DISLQ7E2 Strong Biomarker [5]
Renal carcinoma DISER9XT Strong Genetic Variation [12]
Renal cell carcinoma DISQZ2X8 Strong Genetic Variation [12]
Severe congenital neutropenia DISES99N Strong Genetic Variation [10]
Trichotillomania DISDI464 Strong Genetic Variation [4]
Alopecia DIS37HU4 moderate Genetic Variation [13]
Anxiety DISIJDBA moderate Biomarker [13]
Anxiety disorder DISBI2BT moderate Biomarker [13]
Pancreatic cancer DISJC981 moderate Biomarker [14]
Acute myelogenous leukaemia DISCSPTN Limited Altered Expression [15]
Metastatic malignant neoplasm DIS86UK6 Limited Biomarker [16]
Stomach cancer DISKIJSX Limited Biomarker [16]
------------------------------------------------------------------------------------
⏷ Show the Full List of 29 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
7 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate affects the expression of Homeobox protein Hox-B8 (HOXB8). [17]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Homeobox protein Hox-B8 (HOXB8). [18]
Triclosan DMZUR4N Approved Triclosan increases the expression of Homeobox protein Hox-B8 (HOXB8). [19]
Methotrexate DM2TEOL Approved Methotrexate decreases the expression of Homeobox protein Hox-B8 (HOXB8). [20]
Cytarabine DMZD5QR Approved Cytarabine decreases the expression of Homeobox protein Hox-B8 (HOXB8). [21]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 increases the expression of Homeobox protein Hox-B8 (HOXB8). [23]
EPZ-004777 DMLN4V5 Investigative EPZ-004777 decreases the expression of Homeobox protein Hox-B8 (HOXB8). [24]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Homeobox protein Hox-B8 (HOXB8). [22]
------------------------------------------------------------------------------------

References

1 Expression of selected human HOX-2 genes in B/T acute lymphoid leukemia and interleukin-2/interleukin-1 beta-stimulated natural killer lymphocytes.Blood. 1992 Jul 1;80(1):185-93.
2 Homeobox B8 Targets Sterile Alpha Motif Domain-Containing Protein 9 and Drives Glioma Progression.Neurosci Bull. 2020 Apr;36(4):359-371. doi: 10.1007/s12264-019-00436-y. Epub 2019 Oct 23.
3 HOXB8 enhances the proliferation and metastasis of colorectal cancer cells by promoting EMT via STAT3 activation.Cancer Cell Int. 2019 Jan 3;19:3. doi: 10.1186/s12935-018-0717-6. eCollection 2019.
4 Corticostriatal circuit defects in Hoxb8 mutant mice.Mol Psychiatry. 2018 Sep;23(9):1868-1877. doi: 10.1038/mp.2017.180. Epub 2017 Sep 26.
5 Knockdown of HOXB8 inhibits tumor growth and metastasis by the inactivation of Wnt/-catenin signaling pathway in osteosarcoma.Eur J Pharmacol. 2019 Jul 5;854:22-27. doi: 10.1016/j.ejphar.2019.04.004. Epub 2019 Apr 5.
6 Long non-coding RNA MIF-AS1 promotes breast cancer cell proliferation, migration and EMT process through regulating miR-1249-3p/HOXB8 axis.Pathol Res Pract. 2019 Jul;215(7):152376. doi: 10.1016/j.prp.2019.03.005. Epub 2019 May 4.
7 Assignment of an autosomal sex reversal locus (SRA1) and campomelic dysplasia (CMPD1) to 17q24.3-q25.1.Nat Genet. 1993 Jun;4(2):170-4. doi: 10.1038/ng0693-170.
8 MiR-32-5p regulates the proliferation and metastasis of cervical cancer cells by targeting HOXB8.Eur Rev Med Pharmacol Sci. 2019 Jan;23(1):87-95. doi: 10.26355/eurrev_201901_16752.
9 Oncogenic HOXB8 is driven by MYC-regulated super-enhancer and potentiates colorectal cancer invasiveness via BACH1.Oncogene. 2020 Jan;39(5):1004-1017. doi: 10.1038/s41388-019-1013-1. Epub 2019 Oct 7.
10 Characterisation of Neutropenia-Associated Neutrophil Elastase Mutations in a Murine Differentiation Model In Vitro and In Vivo.PLoS One. 2016 Dec 12;11(12):e0168055. doi: 10.1371/journal.pone.0168055. eCollection 2016.
11 Modulation of HOX2 gene expression following differentiation of neuronal cell lines.Differentiation. 1992 Sep;51(1):39-47. doi: 10.1111/j.1432-0436.1992.tb00678.x.
12 HOX gene expression in normal and neoplastic human kidney.Int J Cancer. 1992 Jul 30;51(6):892-7. doi: 10.1002/ijc.2910510610.
13 Zfp462 deficiency causes anxiety-like behaviors with excessive self-grooming in mice.Genes Brain Behav. 2017 Feb;16(2):296-307. doi: 10.1111/gbb.12339. Epub 2016 Oct 7.
14 LINC01006 promotes cell proliferation and metastasis in pancreatic cancer via miR-2682-5p/HOXB8 axis.Cancer Cell Int. 2019 Dec 2;19:320. doi: 10.1186/s12935-019-1036-2. eCollection 2019.
15 Characteristic patterns of HOX gene expression in different types of human leukemia.Int J Cancer. 1993 Jan 21;53(2):237-44. doi: 10.1002/ijc.2910530211.
16 HOXB8 promotes tumor metastasis and the epithelial-mesenchymal transition via ZEB2 targets in gastric cancer.J Cancer Res Clin Oncol. 2017 Mar;143(3):385-397. doi: 10.1007/s00432-016-2283-4. Epub 2016 Oct 19.
17 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
18 Constitutive gene expression predisposes morphogen-mediated cell fate responses of NT2/D1 and 27X-1 human embryonal carcinoma cells. Stem Cells. 2007 Mar;25(3):771-8. doi: 10.1634/stemcells.2006-0271. Epub 2006 Nov 30.
19 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
20 Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
21 Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
22 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
23 CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
24 DOT1L as a therapeutic target for the treatment of DNMT3A-mutant acute myeloid leukemia. Blood. 2016 Aug 18;128(7):971-81. doi: 10.1182/blood-2015-11-684225. Epub 2016 Jun 22.