Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTKZUA8O)

• DOT Name: Solute carrier family 35 member G1 (SLC35G1)
• Synonyms: Partner of STIM1; Transmembrane protein 20
• Gene Name: SLC35G1
• Related Disease:
  Laron syndrome
  Advanced cancer
  Analgesia
  Atopic dermatitis
  Atrial fibrillation
  Autism
  Depression
  Epilepsy
  Growth delay due to insulin-like growth factor type 1 deficiency
  Hemolytic-uremic syndrome
  Inborn error of immunity
  Kidney failure
  Leukemia
  Mucopolysaccharidosis II
  Myotonic dystrophy
  Neoplasm
  Non-insulin dependent diabetes
  Obesity
  Polycystic ovarian syndrome
  Schizophrenia
  Coronary atherosclerosis
  Myocardial ischemia
  Sensorineural hearing loss disorder
  Werner syndrome
  Acute myelogenous leukaemia
  Breast cancer
  Breast carcinoma
  Colorectal carcinoma
  Hyperglycemia
  Metastatic melanoma
  Occipital horn syndrome
  Overhydrated hereditary stomatocytosis
  Prostate cancer
  Prostate carcinoma
  Type-1 diabetes
  Type-1/2 diabetes
• UniProt ID: S35G1_HUMAN
• Pfam ID: PF00892
• Sequence:
  MRPQDSTGVAELQEPGLPLTDDAPPGATEEPAAAEAAGAPDRGRCWLCLSSPCCSRTEPE
  AKKKAPCPGLGLFYTLLSAFLFSVGSLFVKKVQDVHAVEISAFRCVFQMLVVIPCLIYRK
  TGFIGPKGQRIFLILRGVLGSTAMMLIYYAYQTMSLADATVITFSSPVFTSIFAWICLKE
  KYSPWDALFTVFTITGVILIVRPPFLFGSDTSGMEESYSGHLKGTFAAIGSAVFAASTLV
  ILRKMGKSVDYFLSIWYYVVLGLVESVIILSVLGEWSLPYCGLDRLFLIFIGLFGLGGQI
  FITKALQIEKAGPVAIMKTMDVVFAFIFQIIFFNNVPTWWTVGGALCVVASNVGAAIRKW
  YQSSK
• Function: May play a role in intracellular calcium sensing and homeostasis. May act as a negative regulator of plasma membrane calcium-transporting ATPases preventing calcium efflux from the cell.
• Tissue Specificity: Ubiquitously expressed.

Molecular Interaction Atlas (MIA) of This DOT

36 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Laron syndrome	DISW9H7W	Definitive	Genetic Variation	[1]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[2]
Analgesia	DISK3TVI	Strong	Biomarker	[3]
Atopic dermatitis	DISTCP41	Strong	Biomarker	[4]
Atrial fibrillation	DIS15W6U	Strong	Biomarker	[5]
Autism	DISV4V1Z	Strong	Biomarker	[6]
Depression	DIS3XJ69	Strong	Genetic Variation	[7]
Epilepsy	DISBB28L	Strong	Genetic Variation	[8]
Growth delay due to insulin-like growth factor type 1 deficiency	DISHA2HH	Strong	Biomarker	[9]
Hemolytic-uremic syndrome	DISSCBGW	Strong	Biomarker	[10]
Inborn error of immunity	DISNGCMN	Strong	Biomarker	[11]
Kidney failure	DISOVQ9P	Strong	Biomarker	[10]
Leukemia	DISNAKFL	Strong	Genetic Variation	[12]
Mucopolysaccharidosis II	DIS87GLG	Strong	Altered Expression	[13]
Myotonic dystrophy	DISNBEMX	Strong	Biomarker	[14]
Neoplasm	DISZKGEW	Strong	Biomarker	[15]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Biomarker	[16]
Obesity	DIS47Y1K	Strong	Altered Expression	[17]
Polycystic ovarian syndrome	DISZ2BNG	Strong	Biomarker	[18]
Schizophrenia	DISSRV2N	Strong	Biomarker	[19]
Coronary atherosclerosis	DISKNDYU	moderate	Biomarker	[20]
Myocardial ischemia	DISFTVXF	moderate	Biomarker	[20]
Sensorineural hearing loss disorder	DISJV45Z	moderate	Biomarker	[21]
Werner syndrome	DISZY45W	moderate	Biomarker	[22]
Acute myelogenous leukaemia	DISCSPTN	Limited	Biomarker	[23]
Breast cancer	DIS7DPX1	Limited	Genetic Variation	[24]
Breast carcinoma	DIS2UE88	Limited	Genetic Variation	[24]
Colorectal carcinoma	DIS5PYL0	Limited	Biomarker	[25]
Hyperglycemia	DIS0BZB5	Limited	Biomarker	[26]
Metastatic melanoma	DISSL43L	Limited	Biomarker	[27]
Occipital horn syndrome	DISBA58S	Limited	Biomarker	[28]
Overhydrated hereditary stomatocytosis	DIS6TF7I	Limited	Biomarker	[28]
Prostate cancer	DISF190Y	Limited	Genetic Variation	[29]
Prostate carcinoma	DISMJPLE	Limited	Genetic Variation	[29]
Type-1 diabetes	DIS7HLUB	Limited	Biomarker	[30]
Type-1/2 diabetes	DISIUHAP	Limited	Biomarker	[31]

13 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Solute carrier family 35 member G1 (SLC35G1).	[32]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Solute carrier family 35 member G1 (SLC35G1).	[33]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Solute carrier family 35 member G1 (SLC35G1).	[34]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Solute carrier family 35 member G1 (SLC35G1).	[35]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Solute carrier family 35 member G1 (SLC35G1).	[36]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Solute carrier family 35 member G1 (SLC35G1).	[37]
Demecolcine	DMCZQGK	Approved	Demecolcine decreases the expression of Solute carrier family 35 member G1 (SLC35G1).	[38]
Bortezomib	DMNO38U	Approved	Bortezomib decreases the expression of Solute carrier family 35 member G1 (SLC35G1).	[39]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Solute carrier family 35 member G1 (SLC35G1).	[40]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Solute carrier family 35 member G1 (SLC35G1).	[41]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Solute carrier family 35 member G1 (SLC35G1).	[42]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Solute carrier family 35 member G1 (SLC35G1).	[43]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Solute carrier family 35 member G1 (SLC35G1).	[38]

References

• [1] Growth hormone receptor gene mutations in two Italian patients with Laron Syndrome.J Endocrinol Invest. 2007 May;30(5):417-20. doi: 10.1007/BF03346320.
• [2] Perioperative Lung Resection Outcomes After Implementation of a Multidisciplinary, Evidence-based Thoracic ERAS Program.Ann Surg. 2021 Dec 1;274(6):e1008-e1013. doi: 10.1097/SLA.0000000000003719.
• [3] Variation in postoperative narcotic prescribing after pediatric appendectomy.J Pediatr Surg. 2019 Sep;54(9):1866-1871. doi: 10.1016/j.jpedsurg.2018.11.015. Epub 2019 Feb 7.
• [4] Topical Application of Josamycin Inhibits Development of Atopic Dermatitis-Like Skin Lesions in NC/Nga Mice.J Pharm Pharm Sci. 2017;20:38-47. doi: 10.18433/J3GW3D.
• [5] Predictors of Direct Oral Anticoagulants Utilization for Thromboembolism Prevention in Atrial Fibrillation.J Pharm Pharm Sci. 2017;20:8-14. doi: 10.18433/J30W4F.
• [6] Evidence for alterations in stimulatory G proteins and oxytocin levels in children with autism.Psychoneuroendocrinology. 2014 Feb;40:159-69. doi: 10.1016/j.psyneuen.2013.11.014. Epub 2013 Nov 26.
• [7] Beta Adrenoceptor Polymorphism and Clinical Response to Sertraline in Major Depressive Patients.J Pharm Pharm Sci. 2017;20:1-7. doi: 10.18433/J3W31F.
• [8] Underestimation of sudden deaths among patients with seizures and epilepsy.Neurology. 2017 Aug 29;89(9):886-892. doi: 10.1212/WNL.0000000000004292. Epub 2017 Aug 2.
• [9] Insulin-like growth factor-I deficiency caused by a partial deletion of the IGF-I gene: effects of rhIGF-I therapy.Growth Horm IGF Res. 1999 Jun;9 Suppl B:47-51; discussion 51-2. doi: 10.1016/s1096-6374(99)80081-1.
• [10] A post-partum hemolytic-uremic-like-syndrome in a patient with pre-eclampsia: description of a clinical case.Transfus Apher Sci. 2006 Feb;34(1):11-4. doi: 10.1016/j.transci.2005.09.007. Epub 2006 Jan 20.
• [11] Growth hormone insensitivity resulting from post-GH receptor defects.Growth Horm IGF Res. 2004 Jun;14 Suppl A:S35-8. doi: 10.1016/j.ghir.2004.03.009.
• [12] Glucocorticoid resistance in childhood leukemia.Leuk Lymphoma. 1994 Apr;13(3-4):187-201. doi: 10.3109/10428199409056282.
• [13] Distribution of heparan sulfate and dermatan sulfate in mucopolysaccharidosis type II mouse tissues pre- and post-enzyme-replacement therapy determined by UPLC-MS/MS.Bioanalysis. 2019 Apr;11(8):727-740. doi: 10.4155/bio-2018-0306. Epub 2019 Apr 17.
• [14] Receptor and post-receptor abnormalities contribute to insulin resistance in myotonic dystrophy type 1 and type 2 skeletal muscle.PLoS One. 2017 Sep 15;12(9):e0184987. doi: 10.1371/journal.pone.0184987. eCollection 2017.
• [15] POST-TEXT III and IV Hepatoblastoma: Extended Hepatic Resection Avoids Liver Transplantation in Selected Cases.Ann Surg. 2017 Aug;266(2):318-323. doi: 10.1097/SLA.0000000000001936.
• [16] Heterogeneity within type II and MODY diabetes.Adv Exp Med Biol. 1985;189:65-87. doi: 10.1007/978-1-4757-1850-8_5.
• [17] Insulin inhibits leptin receptor signalling in HEK293 cells at the level of janus kinase-2: a potential mechanism for hyperinsulinaemia-associated leptin resistance.Diabetologia. 2001 Sep;44(9):1125-32. doi: 10.1007/s001250100614.
• [18] Polycystic ovary syndrome is associated with genetic polymorphism in the insulin signaling gene IRS-1 but not ENPP1 in a Japanese population.Life Sci. 2007 Aug 16;81(10):850-4. doi: 10.1016/j.lfs.2007.07.023. Epub 2007 Aug 7.
• [19] Antipsychotic drug actions on gene modulation and signaling mechanisms.Pharmacol Ther. 2009 Oct;124(1):74-85. doi: 10.1016/j.pharmthera.2009.06.001. Epub 2009 Jun 21.
• [20] Post receptor determinants of acute platelet response to clopidogrel in patients with symptomatic myocardial ischemia.Vascul Pharmacol. 2015 Feb-Mar;65-66:17-22. doi: 10.1016/j.vph.2014.11.003. Epub 2014 Nov 20.
• [21] Altered Functional Connectivity in Patients With Sloping Sensorineural Hearing Loss.Front Hum Neurosci. 2019 Aug 22;13:284. doi: 10.3389/fnhum.2019.00284. eCollection 2019.
• [22] Molecular analysis of insulin receptor gene in Werner's syndrome.Diabetes Res Clin Pract. 1994 Dec 31;26(3):171-6. doi: 10.1016/0168-8227(94)90058-2.
• [23] p91 STAT1 activation in interleukin-3-stimulated primary acute myeloid leukemia cells.Oncogene. 1996 Sep 5;13(5):1017-26.
• [24] Association between polymorphisms in the thymidylate synthase gene and risk of breast cancer in a Mexican population.Genet Mol Res. 2014 Oct 27;13(4):8749-56. doi: 10.4238/2014.October.27.16.
• [25] Impact of genetic counseling and testing on colorectal cancer screening behavior.Genet Test. 2002 Winter;6(4):303-6. doi: 10.1089/10906570260471831.
• [26] Insulin resistance in non-insulin dependent (type II) and insulin dependent (type I) diabetes mellitus.Adv Exp Med Biol. 1985;189:176-205.
• [27] Survival trends among patients with metastatic melanoma in the pretargeted and the post-targeted era: a US population-based study.Melanoma Res. 2018 Feb;28(1):56-60. doi: 10.1097/CMR.0000000000000394.
• [28] DNA Methylation Profiling of Blood Monocytes in Patients With Obesity Hypoventilation Syndrome: Effect of Positive Airway Pressure Treatment.Chest. 2016 Jul;150(1):91-101. doi: 10.1016/j.chest.2016.02.648. Epub 2016 Feb 26.
• [29] Targeting androgen receptor action for prostate cancer treatment: does the post-receptor level provide novel opportunities?.Int J Biol Sci. 2014 Jun 1;10(6):576-87. doi: 10.7150/ijbs.8479. eCollection 2014.
• [30] Comparison between preprandial vs. postprandial insulin aspart in patients with type 1 diabetes on insulin pump and real-time continuous glucose monitoring.Diabetes Metab Res Rev. 2018 Sep;34(6):e3019. doi: 10.1002/dmrr.3019. Epub 2018 Jun 1.
• [31] SAFETY AND EFFICACY OF PERSONALIZED GLYCEMIC CONTROL IN CRITICALLY ILL PATIENTS: A 2-YEAR BEFORE AND AFTER INTERVENTIONAL TRIAL.Endocr Pract. 2017 Mar;23(3):318-330. doi: 10.4158/EP161532.OR. Epub 2016 Dec 14.
• [32] Design principles of concentration-dependent transcriptome deviations in drug-exposed differentiating stem cells. Chem Res Toxicol. 2014 Mar 17;27(3):408-20.
• [33] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [34] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [35] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [36] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [37] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [38] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [39] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [40] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [41] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [42] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [43] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.