Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTM040MW)

DOT Name Long-chain-fatty-acid--CoA ligase ACSBG1 (ACSBG1)
Synonyms EC 6.2.1.3; Acyl-CoA synthetase bubblegum family member 1; hBG1; hsBG; hsBGM; Lipidosin
Gene Name ACSBG1
Related Disease
Adrenoleukodystrophy ( )
Advanced cancer ( )
Autoimmune disease ( )
B-cell lymphoma ( )
Breast adenocarcinoma ( )
Breast cancer ( )
Breast carcinoma ( )
Breast neoplasm ( )
Chronic kidney disease ( )
Colitis ( )
Colon carcinoma ( )
Crohn disease ( )
Epstein barr virus infection ( )
Glioma ( )
Hepatocellular carcinoma ( )
Huntington disease ( )
Immunodeficiency ( )
Intestinal obstruction ( )
Irritable bowel syndrome ( )
Late-onset Parkinson disease ( )
Long QT syndrome ( )
Lung cancer ( )
Lung carcinoma ( )
Lymphoma, non-Hodgkin, familial ( )
Mycosis fungoides ( )
Neoplasm ( )
Non-hodgkin lymphoma ( )
Parkinson disease ( )
Plasma cell myeloma ( )
Rheumatoid arthritis ( )
Small lymphocytic lymphoma ( )
Systemic sclerosis ( )
T-cell lymphoma ( )
Ulcerative colitis ( )
Hairy cell leukaemia ( )
Lymphoma ( )
Mantle cell lymphoma ( )
Classic Hodgkin lymphoma ( )
Idiopathic thrombocytopenic purpura ( )
Immune system disorder ( )
Inflammatory bowel disease ( )
Lymphoplasmacytic lymphoma ( )
Lymphoproliferative syndrome ( )
Waldenstrom macroglobulinemia ( )
UniProt ID
ACBG1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
6.2.1.3
Pfam ID
PF00501
Sequence
MPRNSGAGYGCPHGDPSMLDSRETPQESRQDMIVRTTQEKLKTSSLTDRQPLSKESLNHA
LELSVPEKVNNAQWDAPEEALWTTRADGRVRLRIDPSCPQLPYTVHRMFYEALDKYGDLI
ALGFKRQDKWEHISYSQYYLLARRAAKGFLKLGLKQAHSVAILGFNSPEWFFSAVGTVFA
GGIVTGIYTTSSPEACQYIAYDCCANVIMVDTQKQLEKILKIWKQLPHLKAVVIYKEPPP
NKMANVYTMEEFMELGNEVPEEALDAIIDTQQPNQCCVLVYTSGTTGNPKGVMLSQDNIT
WTARYGSQAGDIRPAEVQQEVVVSYLPLSHIAAQIYDLWTGIQWGAQVCFAEPDALKGSL
VNTLREVEPTSHMGVPRVWEKIMERIQEVAAQSGFIRRKMLLWAMSVTLEQNLTCPGSDL
KPFTTRLADYLVLAKVRQALGFAKCQKNFYGAAPMMAETQHFFLGLNIRLYAGYGLSETS
GPHFMSSPYNYRLYSSGKLVPGCRVKLVNQDAEGIGEICLWGRTIFMGYLNMEDKTCEAI
DEEGWLHTGDAGRLDADGFLYITGRLKELIITAGGENVPPVPIEEAVKMELPIISNAMLI
GDQRKFLSMLLTLKCTLDPDTSDQTDNLTEQAMEFCQRVGSRATTVSEIIEKKDEAVYQA
IEEGIRRVNMNAAARPYHIQKWAILERDFSISGGELGPTMKLKRLTVLEKYKGIIDSFYQ
EQKM
Function
Catalyzes the conversion of fatty acids such as long-chain and very long-chain fatty acids to their active form acyl-CoAs for both synthesis of cellular lipids, and degradation via beta-oxidation. Can activate diverse saturated, monosaturated and polyunsaturated fatty acids.
Tissue Specificity Expressed primarily in brain. Expressed at lower level in testis and adrenal gland. Present in all regions of brain except pituitary.
KEGG Pathway
Fatty acid biosynthesis (hsa00061 )
Fatty acid degradation (hsa00071 )
Metabolic pathways (hsa01100 )
Fatty acid metabolism (hsa01212 )
PPAR sig.ling pathway (hsa03320 )
Adipocytokine sig.ling pathway (hsa04920 )
Reactome Pathway
Synthesis of very long-chain fatty acyl-CoAs (R-HSA-75876 )
BioCyc Pathway
MetaCyc:HS02532-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

44 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Adrenoleukodystrophy DISTUD1F Strong Biomarker [1]
Advanced cancer DISAT1Z9 Strong Genetic Variation [2]
Autoimmune disease DISORMTM Strong Biomarker [3]
B-cell lymphoma DISIH1YQ Strong Biomarker [4]
Breast adenocarcinoma DISMPHJ0 Strong Biomarker [5]
Breast cancer DIS7DPX1 Strong Altered Expression [6]
Breast carcinoma DIS2UE88 Strong Genetic Variation [5]
Breast neoplasm DISNGJLM Strong Biomarker [5]
Chronic kidney disease DISW82R7 Strong Altered Expression [7]
Colitis DISAF7DD Strong Biomarker [8]
Colon carcinoma DISJYKUO Strong Biomarker [9]
Crohn disease DIS2C5Q8 Strong Biomarker [8]
Epstein barr virus infection DISOO0WT Strong Biomarker [10]
Glioma DIS5RPEH Strong Genetic Variation [11]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [12]
Huntington disease DISQPLA4 Strong Biomarker [13]
Immunodeficiency DIS093I0 Strong Biomarker [5]
Intestinal obstruction DISE52WH Strong Biomarker [4]
Irritable bowel syndrome DIS27206 Strong Biomarker [8]
Late-onset Parkinson disease DIS9IOUI Strong Biomarker [14]
Long QT syndrome DISMKWS3 Strong Biomarker [15]
Lung cancer DISCM4YA Strong Altered Expression [16]
Lung carcinoma DISTR26C Strong Altered Expression [16]
Lymphoma, non-Hodgkin, familial DISCXYIZ Strong Biomarker [17]
Mycosis fungoides DIS62RB8 Strong Genetic Variation [18]
Neoplasm DISZKGEW Strong Genetic Variation [19]
Non-hodgkin lymphoma DISS2Y8A Strong Biomarker [17]
Parkinson disease DISQVHKL Strong Biomarker [14]
Plasma cell myeloma DIS0DFZ0 Strong Biomarker [17]
Rheumatoid arthritis DISTSB4J Strong Altered Expression [20]
Small lymphocytic lymphoma DIS30POX Strong Biomarker [21]
Systemic sclerosis DISF44L6 Strong Altered Expression [22]
T-cell lymphoma DISSXRTQ Strong Biomarker [18]
Ulcerative colitis DIS8K27O Strong Biomarker [8]
Hairy cell leukaemia DISTD2E5 moderate Biomarker [21]
Lymphoma DISN6V4S moderate Altered Expression [23]
Mantle cell lymphoma DISFREOV moderate Biomarker [21]
Classic Hodgkin lymphoma DISV1LU6 Limited Biomarker [24]
Idiopathic thrombocytopenic purpura DISFKGJU Limited Biomarker [25]
Immune system disorder DISAEGPH Limited Biomarker [25]
Inflammatory bowel disease DISGN23E Limited Biomarker [26]
Lymphoplasmacytic lymphoma DISMSQ11 Limited Biomarker [27]
Lymphoproliferative syndrome DISMVL8O Limited Biomarker [25]
Waldenstrom macroglobulinemia DIS9O23I Limited Biomarker [27]
------------------------------------------------------------------------------------
⏷ Show the Full List of 44 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
4 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Long-chain-fatty-acid--CoA ligase ACSBG1 (ACSBG1). [28]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Long-chain-fatty-acid--CoA ligase ACSBG1 (ACSBG1). [29]
Isotretinoin DM4QTBN Approved Isotretinoin decreases the expression of Long-chain-fatty-acid--CoA ligase ACSBG1 (ACSBG1). [30]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Long-chain-fatty-acid--CoA ligase ACSBG1 (ACSBG1). [31]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Long-chain-fatty-acid--CoA ligase ACSBG1 (ACSBG1). [32]
------------------------------------------------------------------------------------

References

1 Neurodegeneration in a Drosophila model of adrenoleukodystrophy: the roles of the Bubblegum and Double bubble acyl-CoA synthetases.Dis Model Mech. 2016 Apr;9(4):377-87. doi: 10.1242/dmm.022244. Epub 2016 Feb 18.
2 Thyroid fine-needle aspiration and The Bethesda Classification System.Dan Med J. 2018 Mar;65(3):A5456.
3 Abnormal microRNA-16 locus with synteny to human 13q14 linked to CLL in NZB mice.Blood. 2007 Jun 15;109(12):5079-86. doi: 10.1182/blood-2007-02-071225. Epub 2007 Mar 9.
4 Indolent T-cell lymphoproliferative disease with synchronous diffuse large B-cell lymphoma: A case report.Medicine (Baltimore). 2019 Apr;98(17):e15323. doi: 10.1097/MD.0000000000015323.
5 In vivo efficacy of folate-targeted lipid-protamine-DNA (LPD-PEG-Folate) complexes in an immunocompetent syngeneic model for breast adenocarcinoma.Cancer Gene Ther. 2004 Feb;11(2):128-34. doi: 10.1038/sj.cgt.7700662.
6 EGFR-specific PEGylated immunoliposomes for active siRNA delivery in hepatocellular carcinoma.Biomaterials. 2012 Jan;33(1):270-82. doi: 10.1016/j.biomaterials.2011.09.035. Epub 2011 Oct 2.
7 Dietary supplementation with ketoacids protects against CKD-induced oxidative damage and mitochondrial dysfunction in skeletal muscle of 5/6 nephrectomised rats.Skelet Muscle. 2018 May 31;8(1):18. doi: 10.1186/s13395-018-0164-z.
8 Ulcerative colitis, Crohn's disease, and irritable bowel syndrome have different profiles of extracellular matrix turnover, which also reflects disease activity in Crohn's disease.PLoS One. 2017 Oct 13;12(10):e0185855. doi: 10.1371/journal.pone.0185855. eCollection 2017.
9 An N-, C-terminally truncated basic fibroblast growth factor and LPD (liposome-polycation-DNA) complexes elicits a protective immune response against murine colon carcinoma.Cancer Biol Ther. 2010 Aug 1;10(3):276-81. doi: 10.4161/cbt.10.3.12421. Epub 2010 Aug 20.
10 Epstein-Barr virus latent membrane protein-1 oncogene deletion in post-transplantation lymphoproliferative disorders.Am J Pathol. 1997 Sep;151(3):805-12.
11 Integrated Metabolomics and Lipidomics Analyses Reveal Metabolic Reprogramming in Human Glioma with IDH1 Mutation.J Proteome Res. 2019 Mar 1;18(3):960-969. doi: 10.1021/acs.jproteome.8b00663. Epub 2019 Jan 9.
12 Feasibility and Safety of Repeated Transarterial Chemoembolization Using Miriplatin-Lipiodol Suspension for Hepatocellular Carcinoma.Anticancer Res. 2017 Jun;37(6):3183-3187. doi: 10.21873/anticanres.11678.
13 Predictive testing for Huntington's disease with use of a linked DNA marker.N Engl J Med. 1988 Mar 3;318(9):535-42. doi: 10.1056/NEJM198803033180903.
14 Clinical characteristics and quality of life in Chinese patients with Parkinson's disease beyond 20years.Neurol Res. 2018 Apr;40(4):312-317. doi: 10.1080/01616412.2018.1438227. Epub 2018 Feb 15.
15 A wearable remote monitoring system for the identification of subjects with a prolonged QT interval or at risk for drug-induced long QT syndrome.Int J Cardiol. 2018 Sep 1;266:89-94. doi: 10.1016/j.ijcard.2018.03.097.
16 Very long-chain acyl-CoA synthetase 3: overexpression and growth dependence in lung cancer.PLoS One. 2013 Jul 23;8(7):e69392. doi: 10.1371/journal.pone.0069392. Print 2013.
17 BCL-6 gene mutations in posttransplantation lymphoproliferative disorders predict response to therapy and clinical outcome.Blood. 1998 Oct 1;92(7):2294-302.
18 Nodal involvement by cutaneous CD30-positive T-cell lymphoma mimicking classical Hodgkin lymphoma.Am J Surg Pathol. 2012 May;36(5):716-25. doi: 10.1097/PAS.0b013e3182487158.
19 Primary cutaneous CD4+ small- to medium-sized pleomorphic T-cell lymphoproliferative disorder in a pediatric patient successfully treated with low-dose radiation.Pediatr Dermatol. 2019 Jan;36(1):e23-e26. doi: 10.1111/pde.13728. Epub 2018 Dec 11.
20 Prognostic factors of methotrexate-associated lymphoproliferative disorders associated with rheumatoid arthritis and plausible application of biological agents.Mod Rheumatol. 2017 Sep;27(5):773-777. doi: 10.1080/14397595.2016.1259714. Epub 2016 Dec 15.
21 Differential and tumor-specific expression of CD160 in B-cell malignancies.Blood. 2011 Aug 25;118(8):2174-83. doi: 10.1182/blood-2011-02-334326. Epub 2011 Jun 28.
22 Citrullinated vimentin and biglycan protein fingerprints as candidate serological biomarkers for disease activity in systemic sclerosis: a pilot study.Biomarkers. 2019 May;24(3):249-254. doi: 10.1080/1354750X.2018.1548032. Epub 2018 Dec 3.
23 A new era for cutaneous CD30-positive T-cell lymphoproliferative disorders.Semin Diagn Pathol. 2017 Jan;34(1):22-35. doi: 10.1053/j.semdp.2016.11.005. Epub 2016 Nov 29.
24 Clinicopathologic investigation of methotrexate-induced lymphoproliferative disorders, with a focus on regression.Leuk Lymphoma. 2018 May;59(5):1143-1152. doi: 10.1080/10428194.2017.1369073. Epub 2017 Sep 7.
25 Use of eltrombopag for patients 65years old or older with immune thrombocytopenia.Eur J Haematol. 2020 Mar;104(3):259-270. doi: 10.1111/ejh.13370. Epub 2020 Feb 3.
26 Primary Intestinal Epstein-Barr Virus-associated Natural Killer/T-cell Lymphoproliferative Disorder: A Disease Mimicking Inflammatory Bowel Disease.J Crohns Colitis. 2018 Jul 30;12(8):896-904. doi: 10.1093/ecco-jcc/jjy043.
27 CD13 expression in B cell malignancies is a hallmark of plasmacytic differentiation.Br J Haematol. 2019 Feb;184(4):625-633. doi: 10.1111/bjh.15584. Epub 2018 Sep 10.
28 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
29 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
30 Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
31 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
32 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.