Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTNX23LE)

• DOT Name: Adiponectin (ADIPOQ)
• Synonyms: 30 kDa adipocyte complement-related protein; Adipocyte complement-related 30 kDa protein; ACRP30; Adipocyte, C1q and collagen domain-containing protein; Adipose most abundant gene transcript 1 protein; apM-1; Gelatin-binding protein
• Gene Name: ADIPOQ
• Related Disease: STAT3-related early-onset multisystem autoimmune disease
• UniProt ID: ADIPO_HUMAN
• PDB ID: 4DOU; 6U66; 6U6N
• Pfam ID: PF00386 ; PF01391
• Sequence:
  MLLLGAVLLLLALPGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDG
  TPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLE
  TYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDK
  AMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLY
  HDTN
• Function: Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW.
• Tissue Specificity: Synthesized exclusively by adipocytes and secreted into plasma.
• KEGG Pathway:
  PPAR sig.ling pathway (hsa03320)
  AMPK sig.ling pathway (hsa04152)
  Longevity regulating pathway (hsa04211)
  Adipocytokine sig.ling pathway (hsa04920)
  Type II diabetes mellitus (hsa04930)
  Non-alcoholic fatty liver disease (hsa04932)
  Alcoholic liver disease (hsa04936)
• Reactome Pathway:
  Transcriptional regulation of white adipocyte differentiation (R-HSA-381340)
  AMPK inhibits chREBP transcriptional activation activity (R-HSA-163680)

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
STAT3-related early-onset multisystem autoimmune disease	DISAXTN7	Limited	Unknown	[1]

This DOT Affected the Drug Response of 4 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Ethanol	DMDRQZU	Approved	Adiponectin (ADIPOQ) decreases the response to substance of Ethanol.	[38]
Lindane	DMB8CNL	Approved	Adiponectin (ADIPOQ) affects the response to substance of Lindane.	[39]
Amprenavir	DMLMXE0	Approved	Adiponectin (ADIPOQ) increases the Insulin resistance ADR of Amprenavir.	[41]
VRX496	DMIO4V5	Approved	Adiponectin (ADIPOQ) increases the Insulin resistance ADR of VRX496.	[41]

This DOT Affected the Regulation of Drug Effects of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
2-deoxyglucose	DMIAHVU	Approved	Adiponectin (ADIPOQ) increases the uptake of 2-deoxyglucose.	[40]
[3H]cAMP	DMZRQU7	Investigative	Adiponectin (ADIPOQ) increases the abundance of [3H]cAMP.	[42]

42 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Adiponectin (ADIPOQ).	[2]
Arsenic	DMTL2Y1	Approved	Arsenic decreases the expression of Adiponectin (ADIPOQ).	[3]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Adiponectin (ADIPOQ).	[4]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Adiponectin (ADIPOQ).	[5]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Adiponectin (ADIPOQ).	[6]
Marinol	DM70IK5	Approved	Marinol increases the expression of Adiponectin (ADIPOQ).	[7]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Adiponectin (ADIPOQ).	[8]
Troglitazone	DM3VFPD	Approved	Troglitazone increases the expression of Adiponectin (ADIPOQ).	[9]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone increases the expression of Adiponectin (ADIPOQ).	[10]
Clozapine	DMFC71L	Approved	Clozapine decreases the expression of Adiponectin (ADIPOQ).	[11]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol decreases the expression of Adiponectin (ADIPOQ).	[12]
Gemcitabine	DMSE3I7	Approved	Gemcitabine increases the expression of Adiponectin (ADIPOQ).	[13]
Fenofibrate	DMFKXDY	Approved	Fenofibrate increases the expression of Adiponectin (ADIPOQ).	[14]
Zidovudine	DM4KI7O	Approved	Zidovudine decreases the expression of Adiponectin (ADIPOQ).	[15]
Pioglitazone	DMKJ485	Approved	Pioglitazone increases the expression of Adiponectin (ADIPOQ).	[16]
Ritonavir	DMU764S	Approved	Ritonavir decreases the expression of Adiponectin (ADIPOQ).	[15]
Bezafibrate	DMZDCS0	Approved	Bezafibrate increases the expression of Adiponectin (ADIPOQ).	[17]
Melatonin	DMKWFBT	Approved	Melatonin decreases the expression of Adiponectin (ADIPOQ).	[18]
Hesperetin	DMKER83	Approved	Hesperetin decreases the expression of Adiponectin (ADIPOQ).	[20]
Nevirapine	DM6HX9B	Approved	Nevirapine increases the expression of Adiponectin (ADIPOQ).	[21]
Nelfinavir mesylate	DMFX6G8	Approved	Nelfinavir mesylate decreases the expression of Adiponectin (ADIPOQ).	[15]
Vitamin B3	DMQVRZH	Approved	Vitamin B3 increases the expression of Adiponectin (ADIPOQ).	[22]
Efavirenz	DMC0GSJ	Approved	Efavirenz decreases the expression of Adiponectin (ADIPOQ).	[21]
Carvedilol	DMHTEAO	Approved	Carvedilol decreases the expression of Adiponectin (ADIPOQ).	[23]
Benzbromarone	DMC3YUA	Approved	Benzbromarone increases the expression of Adiponectin (ADIPOQ).	[24]
Amlodipine	DMBDAZV	Approved	Amlodipine increases the expression of Adiponectin (ADIPOQ).	[25]
Stavudine	DM6DEK9	Approved	Stavudine decreases the expression of Adiponectin (ADIPOQ).	[15]
Indinavir	DM0T3YH	Approved	Indinavir decreases the expression of Adiponectin (ADIPOQ).	[15]
Lopinavir	DMITQS0	Approved	Lopinavir decreases the expression of Adiponectin (ADIPOQ).	[15]
Candesartan	DMRK8OT	Approved	Candesartan increases the expression of Adiponectin (ADIPOQ).	[14]
Ramipril	DM2R68E	Approved	Ramipril decreases the expression of Adiponectin (ADIPOQ).	[26]
Cilazapril	DM4V6JA	Approved	Cilazapril increases the expression of Adiponectin (ADIPOQ).	[27]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Adiponectin (ADIPOQ).	[28]
Atorvastatin	DMF28YC	Phase 3 Trial	Atorvastatin decreases the expression of Adiponectin (ADIPOQ).	[29]
Telmisartan	DMS3GX2	Phase 3 Trial	Telmisartan increases the expression of Adiponectin (ADIPOQ).	[30]
GSK2816126	DMJDVW4	Phase 1	GSK2816126 decreases the expression of Adiponectin (ADIPOQ).	[32]
PJ34	DMXO6YH	Preclinical	PJ34 increases the expression of Adiponectin (ADIPOQ).	[16]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Adiponectin (ADIPOQ).	[33]
BADGE	DMCK5DG	Investigative	BADGE increases the expression of Adiponectin (ADIPOQ).	[35]
isobutylmethylxanthine	DM46F5X	Investigative	isobutylmethylxanthine decreases the expression of Adiponectin (ADIPOQ).	[36]
3-aminobenzamide	DM7P3IZ	Investigative	3-aminobenzamide increases the expression of Adiponectin (ADIPOQ).	[16]
bongkrek acid	DMWALXQ	Investigative	bongkrek acid increases the expression of Adiponectin (ADIPOQ).	[37]

3 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Eicosapentaenoic acid/docosa-hexaenoic acid	DMMUCG4	Approved	Eicosapentaenoic acid/docosa-hexaenoic acid increases the secretion of Adiponectin (ADIPOQ).	[19]
D-glucose	DMMG2TO	Investigative	D-glucose increases the secretion of Adiponectin (ADIPOQ).	[34]
Icosapentum	DMF1CM7	Investigative	Icosapentum increases the secretion of Adiponectin (ADIPOQ).	[19]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Adiponectin (ADIPOQ).	[31]

References

• [1] Genomic structure and mutations in adipose-specific gene, adiponectin. Int J Obes Relat Metab Disord. 2000 Jul;24(7):861-8. doi: 10.1038/sj.ijo.0801244.
• [2] Comparison of insulin resistance, metabolic syndrome and adiponectin in overweight bipolar patients taking sodium valproate and controls. Aust N Z J Psychiatry. 2009 Jan;43(1):53-60. doi: 10.1080/00048670802534341.
• [3] Arsenic inhibits the adipogenic differentiation of mesenchymal stem cells by down-regulating peroxisome proliferator-activated receptor gamma and CCAAT enhancer-binding proteins. Toxicol In Vitro. 2013 Feb;27(1):211-9. doi: 10.1016/j.tiv.2012.10.012. Epub 2012 Oct 26.
• [4] Role of PML SUMOylation in arsenic trioxide-induced fibrosis in HSCs. Life Sci. 2020 Jun 15;251:117607. doi: 10.1016/j.lfs.2020.117607. Epub 2020 Mar 30.
• [5] Serum adiponectin and leptin levels in relation to the metabolic syndrome, androgenic profile and somatotropic axis in healthy non-diabetic elderly men. Eur J Endocrinol. 2006 Jul;155(1):167-76. doi: 10.1530/eje.1.02175.
• [6] Cytotoxicity and inhibitory effects of low-concentration triclosan on adipogenic differentiation of human mesenchymal stem cells. Toxicol Appl Pharmacol. 2012 Jul 15;262(2):117-23. doi: 10.1016/j.taap.2012.04.024. Epub 2012 May 1.
• [7] (9)-Tetrahydrocannabinol upregulates fatty acid 2-hydroxylase (FA2H) via PPAR induction: A possible evidence for the cancellation of PPAR/-mediated inhibition of PPAR in MDA-MB-231?cells. Arch Biochem Biophys. 2019 Feb 15;662:219-225. doi: 10.1016/j.abb.2018.12.011. Epub 2018 Dec 13.
• [8] Dexamethasone and the inflammatory response in explants of human omental adipose tissue. Mol Cell Endocrinol. 2010 Feb 5;315(1-2):292-8.
• [9] Adipogenic Effects and Gene Expression Profiling of Firemaster? 550 Components in Human Primary Preadipocytes. Environ Health Perspect. 2017 Sep 14;125(9):097013. doi: 10.1289/EHP1318.
• [10] Effects of rosiglitazone and metformin on liver fat content, hepatic insulin resistance, insulin clearance, and gene expression in adipose tissue in patients with type 2 diabetes. Diabetes. 2004 Aug;53(8):2169-76. doi: 10.2337/diabetes.53.8.2169.
• [11] Adiponectin as a potential biomarker for the metabolic syndrome in Chinese patients taking clozapine for schizophrenia. J Clin Psychiatry. 2007 Dec;68(12):1834-9. doi: 10.4088/jcp.v68n1202.
• [12] The genomic response of a human uterine endometrial adenocarcinoma cell line to 17alpha-ethynyl estradiol. Toxicol Sci. 2009 Jan;107(1):40-55.
• [13] Metronomic gemcitabine suppresses tumour growth, improves perfusion, and reduces hypoxia in human pancreatic ductal adenocarcinoma. Br J Cancer. 2010 Jun 29;103(1):52-60.
• [14] Additive beneficial effects of fenofibrate combined with candesartan in the treatment of hypertriglyceridemic hypertensive patients. Diabetes Care. 2006 Feb;29(2):195-201. doi: 10.2337/diacare.29.02.06.dc05-1418.
• [15] Some HIV antiretrovirals increase oxidative stress and alter chemokine, cytokine or adiponectin production in human adipocytes and macrophages. Antivir Ther. 2007;12(4):489-500.
• [16] PARP-1 suppresses adiponectin expression through poly(ADP-ribosyl)ation of PPAR gamma in cardiac fibroblasts. Cardiovasc Res. 2009 Jan 1;81(1):98-107. doi: 10.1093/cvr/cvn264. Epub 2008 Sep 24.
• [17] Comparison of effects of bezafibrate and fenofibrate on circulating proprotein convertase subtilisin/kexin type 9 and adipocytokine levels in dyslipidemic subjects with impaired glucose tolerance or type 2 diabetes mellitus: results from a crossover study. Atherosclerosis. 2011 Jul;217(1):165-70. doi: 10.1016/j.atherosclerosis.2011.02.012. Epub 2011 Feb 22.
• [18] Melatonin inhibits adipogenesis and enhances osteogenesis of human mesenchymal stem cells by suppressing PPAR expression and enhancing Runx2 expression. J Pineal Res. 2010 Nov;49(4):364-72. doi: 10.1111/j.1600-079X.2010.00803.x. Epub 2010 Aug 24.
• [19] Eicosapentaenoic acid and rosiglitazone increase adiponectin in an additive and PPAR-dependent manner in human adipocytes. Obesity (Silver Spring). 2011 Feb;19(2):262-8. doi: 10.1038/oby.2010.186. Epub 2010 Sep 2.
• [20] Hesperetin inhibit adipocyte differentiation and enhance Bax- and p21-mediated adipolysis in human mesenchymal stem cell adipogenesis. J Biochem Mol Toxicol. 2015 Mar;29(3):99-108. doi: 10.1002/jbt.21672. Epub 2014 Oct 26.
• [21] Effects of nevirapine and efavirenz on human adipocyte differentiation, gene expression, and release of adipokines and cytokines. Antiviral Res. 2011 Aug;91(2):112-9. doi: 10.1016/j.antiviral.2011.04.018. Epub 2011 May 17.
• [22] Effects of extended-release niacin on lipid profile and adipocyte biology in patients with impaired glucose tolerance. Atherosclerosis. 2009 Jul;205(1):207-13. doi: 10.1016/j.atherosclerosis.2008.11.026. Epub 2008 Dec 3.
• [23] Effect of carvedilol on plasma adiponectin concentration in patients with chronic heart failure. Circ J. 2009 Jun;73(6):1067-73. doi: 10.1253/circj.cj-08-1026. Epub 2009 Apr 14.
• [24] Effects of benzbromarone and allopurinol on adiponectin in vivo and in vitro. Horm Metab Res. 2009 Apr;41(4):327-32. doi: 10.1055/s-0028-1102947. Epub 2008 Dec 1.
• [25] Amlodipine improves endothelial function and metabolic parameters in patients with hypertension. Int J Cardiol. 2009 Mar 20;133(1):23-31. doi: 10.1016/j.ijcard.2007.11.058. Epub 2008 Jan 15.
• [26] Additive beneficial cardiovascular and metabolic effects of combination therapy with ramipril and candesartan in hypertensive patients. Eur Heart J. 2007 Jun;28(12):1440-7. doi: 10.1093/eurheartj/ehm101. Epub 2007 May 5.
• [27] Combination of an ACE inhibitor and indapamide improves blood pressure control, but attenuates the beneficial effects of ACE inhibition on plasma adiponectin in patients with essential hypertension. Circ J. 2009 Dec;73(12):2282-7. doi: 10.1253/circj.cj-09-0387. Epub 2009 Sep 29.
• [28] Grape resveratrol increases serum adiponectin and downregulates inflammatory genes in peripheral blood mononuclear cells: a triple-blind, placebo-controlled, one-year clinical trial in patients with stable coronary artery disease. Cardiovasc Drugs Ther. 2013 Feb;27(1):37-48. doi: 10.1007/s10557-012-6427-8.
• [29] Additive beneficial effects of atorvastatin combined with amlodipine in patients with mild-to-moderate hypertension. Int J Cardiol. 2011 Feb 3;146(3):319-25. doi: 10.1016/j.ijcard.2009.07.002. Epub 2009 Aug 3.
• [30] Improvement of endothelial function in patients with hypertension and type 2 diabetes after treatment with telmisartan. Hypertens Res. 2010 Aug;33(8):796-801. doi: 10.1038/hr.2010.107. Epub 2010 Jun 17.
• [31] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [32] Epigenetic control of skeletal development by the histone methyltransferase Ezh2. J Biol Chem. 2015 Nov 13;290(46):27604-17.
• [33] Cultured human peripheral blood mononuclear cells alter their gene expression when challenged with endocrine-disrupting chemicals. Toxicology. 2013 Jan 7;303:17-24.
• [34] Calorie restriction-induced changes in the secretome of human adipocytes, comparison with resveratrol-induced secretome effects. Biochim Biophys Acta. 2014 Sep;1844(9):1511-22. doi: 10.1016/j.bbapap.2014.04.023. Epub 2014 May 5.
• [35] Bisphenol A diglycidyl ether induces adipogenic differentiation of multipotent stromal stem cells through a peroxisome proliferator-activated receptor gamma-independent mechanism. Environ Health Perspect. 2012 Jul;120(7):984-9. doi: 10.1289/ehp.1205063. Epub 2012 May 25.
• [36] Aloe-emodin inhibits adipocyte differentiation and maturation during in vitro human mesenchymal stem cell adipogenesis. J Biochem Mol Toxicol. 2012 Aug;26(8):291-300. doi: 10.1002/jbt.21415. Epub 2012 May 29.
• [37] Bongkrekic acid as a selective activator of the peroxisome proliferator-activated receptor (PPAR) isoform. J Toxicol Sci. 2015 Apr;40(2):223-33. doi: 10.2131/jts.40.223.
• [38] Modulation of Atg5 expression by globular adiponectin contributes to autophagy flux and suppression of ethanol-induced cell death in liver cells. Food Chem Toxicol. 2014 Jun;68:11-22. doi: 10.1016/j.fct.2014.02.027. Epub 2014 Feb 27.
• [39] Interaction between -hexachlorocyclohexane and ADIPOQ genotypes contributes to the risk of type 2 diabetes mellitus in East Chinese adults. Sci Rep. 2016 Nov 24;6:37769. doi: 10.1038/srep37769.
• [40] A collagen domain-derived short adiponectin peptide activates APPL1 and AMPK signaling pathways and improves glucose and fatty acid metabolisms. J Biol Chem. 2018 Aug 31;293(35):13509-13523. doi: 10.1074/jbc.RA118.001801. Epub 2018 Jul 10.
• [41] ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.
• [42] Adiponectin upregulates ferritin heavy chain in skeletal muscle cells. Diabetes. 2009 Jan;58(1):61-70. doi: 10.2337/db07-0690. Epub 2008 Oct 17.