Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTODMJ1D)

• DOT Name: Epithelial membrane protein 3 (EMP3)
• Synonyms: EMP-3; Hematopoietic neural membrane protein 1; HNMP-1; Protein YMP
• Gene Name: EMP3
• Related Disease:
  Esophageal squamous cell carcinoma
  Adult glioblastoma
  Advanced cancer
  Astrocytoma
  Breast cancer
  Carcinoma of esophagus
  Endometrial cancer
  Endometrial carcinoma
  Esophageal cancer
  Gastric cancer
  Lung cancer
  Lung carcinoma
  Malignant glioma
  Neoplasm
  Neoplasm of esophagus
  Neuroblastoma
  Non-small-cell lung cancer
  Pheochromocytoma
  Prostate cancer
  Prostate neoplasm
  Stomach cancer
  Transitional cell carcinoma
  Urothelial carcinoma
  Keratoconus
  Squamous cell carcinoma
  Gallbladder cancer
  Gallbladder carcinoma
  Glioblastoma multiforme
  Glioma
• UniProt ID: EMP3_HUMAN
• Pfam ID: PF00822
• Sequence:
  MSLLLLVVSALHILILILLFVATLDKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSEN
  GWLKAVQVLMVLSLILCCLSFILFMFQLYTMRRGGLFYATGLCQLCTSVAVFTGALIYAI
  HAEEILEKHPRGGSFGYCFALAWVAFPLALVSGIIYIHLRKRE
• Function: Probably involved in cell proliferation and cell-cell interactions.
• KEGG Pathway: TGF-beta sig.ling pathway (hsa04350)

Molecular Interaction Atlas (MIA) of This DOT

29 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Esophageal squamous cell carcinoma	DIS5N2GV	Definitive	Biomarker	[1]
Adult glioblastoma	DISVP4LU	Strong	Altered Expression	[2]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[3]
Astrocytoma	DISL3V18	Strong	Biomarker	[4]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[3]
Carcinoma of esophagus	DISS6G4D	Strong	Posttranslational Modification	[5]
Endometrial cancer	DISW0LMR	Strong	Biomarker	[6]
Endometrial carcinoma	DISXR5CY	Strong	Biomarker	[6]
Esophageal cancer	DISGB2VN	Strong	Posttranslational Modification	[5]
Gastric cancer	DISXGOUK	Strong	Biomarker	[7]
Lung cancer	DISCM4YA	Strong	Altered Expression	[1]
Lung carcinoma	DISTR26C	Strong	Altered Expression	[1]
Malignant glioma	DISFXKOV	Strong	Biomarker	[8]
Neoplasm	DISZKGEW	Strong	Biomarker	[9]
Neoplasm of esophagus	DISOLKAQ	Strong	Posttranslational Modification	[5]
Neuroblastoma	DISVZBI4	Strong	Biomarker	[1]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[1]
Pheochromocytoma	DIS56IFV	Strong	Posttranslational Modification	[10]
Prostate cancer	DISF190Y	Strong	Biomarker	[11]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[11]
Stomach cancer	DISKIJSX	Strong	Biomarker	[7]
Transitional cell carcinoma	DISWVVDR	Strong	Altered Expression	[3]
Urothelial carcinoma	DISRTNTN	Strong	Altered Expression	[3]
Keratoconus	DISOONXH	moderate	Altered Expression	[12]
Squamous cell carcinoma	DISQVIFL	moderate	Altered Expression	[13]
Gallbladder cancer	DISXJUAF	Limited	Altered Expression	[14]
Gallbladder carcinoma	DISD6ACL	Limited	Altered Expression	[14]
Glioblastoma multiforme	DISK8246	Limited	Altered Expression	[2]
Glioma	DIS5RPEH	Limited	Posttranslational Modification	[15]

28 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Epithelial membrane protein 3 (EMP3).	[16]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Epithelial membrane protein 3 (EMP3).	[17]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Epithelial membrane protein 3 (EMP3).	[18]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Epithelial membrane protein 3 (EMP3).	[19]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Epithelial membrane protein 3 (EMP3).	[20]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Epithelial membrane protein 3 (EMP3).	[21]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Epithelial membrane protein 3 (EMP3).	[22]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Epithelial membrane protein 3 (EMP3).	[23]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Epithelial membrane protein 3 (EMP3).	[24]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Epithelial membrane protein 3 (EMP3).	[25]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Epithelial membrane protein 3 (EMP3).	[26]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Epithelial membrane protein 3 (EMP3).	[27]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Epithelial membrane protein 3 (EMP3).	[28]
Selenium	DM25CGV	Approved	Selenium increases the expression of Epithelial membrane protein 3 (EMP3).	[29]
Azathioprine	DMMZSXQ	Approved	Azathioprine increases the expression of Epithelial membrane protein 3 (EMP3).	[30]
Etoposide	DMNH3PG	Approved	Etoposide increases the expression of Epithelial membrane protein 3 (EMP3).	[31]
Paclitaxel	DMLB81S	Approved	Paclitaxel increases the expression of Epithelial membrane protein 3 (EMP3).	[32]
Menthol	DMG2KW7	Approved	Menthol increases the expression of Epithelial membrane protein 3 (EMP3).	[33]
Cyclophosphamide	DM4O2Z7	Approved	Cyclophosphamide increases the expression of Epithelial membrane protein 3 (EMP3).	[31]
Dactinomycin	DM2YGNW	Approved	Dactinomycin increases the expression of Epithelial membrane protein 3 (EMP3).	[31]
Seocalcitol	DMKL9QO	Phase 3	Seocalcitol decreases the expression of Epithelial membrane protein 3 (EMP3).	[34]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Epithelial membrane protein 3 (EMP3).	[29]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Epithelial membrane protein 3 (EMP3).	[36]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Epithelial membrane protein 3 (EMP3).	[37]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Epithelial membrane protein 3 (EMP3).	[38]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Epithelial membrane protein 3 (EMP3).	[39]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Epithelial membrane protein 3 (EMP3).	[40]
OXYQUINOLINE	DMZVS9Y	Investigative	OXYQUINOLINE increases the expression of Epithelial membrane protein 3 (EMP3).	[24]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Epithelial membrane protein 3 (EMP3).	[35]

References

• [1] Epithelial membrane protein 3 is frequently shown as promoter methylation and functions as a tumor suppressor gene in non-small cell lung cancer.Exp Mol Pathol. 2013 Dec;95(3):313-8. doi: 10.1016/j.yexmp.2013.07.001. Epub 2013 Aug 3.
• [2] High EMP3 expression might independently predict poor overall survival in glioblastoma and its expression is related to DNA methylation.Medicine (Baltimore). 2018 Jan;97(1):e9538. doi: 10.1097/MD.0000000000009538.
• [3] EMP1, EMP 2, and EMP3 as novel therapeutic targets in human cancer.Biochim Biophys Acta Rev Cancer. 2017 Aug;1868(1):199-211. doi: 10.1016/j.bbcan.2017.04.004. Epub 2017 Apr 10.
• [4] DNA hypermethylation and aberrant expression of the EMP3 gene at 19q13.3 in Human Gliomas.Brain Pathol. 2007 Oct;17(4):363-70. doi: 10.1111/j.1750-3639.2007.00083.x. Epub 2007 Jul 4.
• [5] EMP3 as a candidate tumor suppressor gene for solid tumors.Expert Opin Ther Targets. 2009 Jul;13(7):811-22. doi: 10.1517/14728220902988549.
• [6] Estrogen receptor alpha activates MAPK signaling pathway to promote the development of endometrial cancer.J Cell Biochem. 2019 Oct;120(10):17593-17601. doi: 10.1002/jcb.29027. Epub 2019 May 29.
• [7] EMP3 is induced by TWIST1/2 and regulates epithelial-to-mesenchymal transition of gastric cancer cells.Tumour Biol. 2017 Jul;39(7):1010428317718404. doi: 10.1177/1010428317718404.
• [8] Whole-Genome Expression Microarray Combined with Machine Learning to Identify Prognostic Biomarkers for High-Grade Glioma.J Mol Neurosci. 2018 Apr;64(4):491-500. doi: 10.1007/s12031-018-1049-7. Epub 2018 Mar 3.
• [9] Characterization of the epithelial membrane protein 3 interaction network reveals a potential functional link to mitogenic signal transduction regulation.Int J Cancer. 2019 Jul 15;145(2):461-473. doi: 10.1002/ijc.32107. Epub 2019 Jan 20.
• [10] Evaluation of a functional epigenetic approach to identify promoter region methylation in phaeochromocytoma and neuroblastoma.Endocr Relat Cancer. 2008 Sep;15(3):777-86. doi: 10.1677/ERC-08-0072. Epub 2008 May 22.
• [11] Analysis of candidate genes for prostate cancer.Hum Hered. 2004;57(4):172-8. doi: 10.1159/000081443.
• [12] Altered expression of CLC, DSG3, EMP3, S100A2, and SLPI in corneal epithelium from keratoconus patients.Cornea. 2005 Aug;24(6):661-8. doi: 10.1097/01.ico.0000153556.59407.69.
• [13] EMP3 as a tumor suppressor gene for esophageal squamous cell carcinoma.Cancer Lett. 2009 Feb 8;274(1):25-32. doi: 10.1016/j.canlet.2008.08.021. Epub 2008 Sep 26.
• [14] RETRACTED: EMP3, which is regulated by miR-663a, suppresses gallbladder cancer progression via interference with the MAPK/ERK pathway.Cancer Lett. 2018 Aug 28;430:97-108. doi: 10.1016/j.canlet.2018.05.022. Epub 2018 May 17.
• [15] EMP3, a myelin-related gene located in the critical 19q13.3 region, is epigenetically silenced and exhibits features of a candidate tumor suppressor in glioma and neuroblastoma.Cancer Res. 2005 Apr 1;65(7):2565-71. doi: 10.1158/0008-5472.CAN-04-4283.
• [16] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [17] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [18] Retinoic acid-induced downmodulation of telomerase activity in human cancer cells. Exp Mol Pathol. 2005 Oct;79(2):108-17.
• [19] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [20] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [21] Apoptosis-related mRNA expression profiles of ovarian cancer cell lines following cisplatin treatment. J Gynecol Oncol. 2010 Dec 30;21(4):255-61. doi: 10.3802/jgo.2010.21.4.255. Epub 2010 Dec 31.
• [22] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [23] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [24] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [25] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [26] Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
• [27] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [28] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [29] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [30] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [31] Genomic profiling uncovers a molecular pattern for toxicological characterization of mutagens and promutagens in vitro. Toxicol Sci. 2011 Jul;122(1):185-97.
• [32] Identification of selective inhibitors of cancer stem cells by high-throughput screening. Cell. 2009 Aug 21;138(4):645-659. doi: 10.1016/j.cell.2009.06.034. Epub 2009 Aug 13.
• [33] Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
• [34] Expression profiling in squamous carcinoma cells reveals pleiotropic effects of vitamin D3 analog EB1089 signaling on cell proliferation, differentiation, and immune system regulation. Mol Endocrinol. 2002 Jun;16(6):1243-56.
• [35] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [36] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [37] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [38] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [39] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [40] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.