Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTOTZVEY)

• DOT Name: UDP-glucuronosyltransferase 1A10
• Synonyms: UGT1A10; EC 2.4.1.17; UDP-glucuronosyltransferase 1-10; UDPGT 1-10; UGT1*10; UGT1-10; UGT1.10; UDP-glucuronosyltransferase 1-J; UGT-1J; UGT1J
• Gene Name: UGT1A10
• UniProt ID: UD110_HUMAN
• EC Number: 2.4.1.17
• Pfam ID: PF00201
• Sequence:
  MARAGWTSPVPLCVCLLLTCGFAEAGKLLVVPMDGSHWFTMQSVVEKLILRGHEVVVVMP
  EVSWQLERSLNCTVKTYSTSYTLEDQNREFMVFAHAQWKAQAQSIFSLLMSSSSGFLDLF
  FSHCRSLFNDRKLVEYLKESSFDAVFLDPFDTCGLIVAKYFSLPSVVFTRGIFCHHLEEG
  AQCPAPLSYVPNDLLGFSDAMTFKERVWNHIVHLEDHLFCQYLFRNALEIASEILQTPVT
  AYDLYSHTSIWLLRTDFVLDYPKPVMPNMIFIGGINCHQGKPLPMEFEAYINASGEHGIV
  VFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGH
  PMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDL
  ENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTW
  YQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH
• Function: [Isoform 1]: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile. Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds. Catalyzes the glucuronidation of endogenous estrogen hormones such as estradiol, estrone and estriol. Also catalyzes the glucuronidation of the isoflavones genistein, daidzein, glycitein, formononetin, biochanin A and prunetin, which are phytoestrogens with anticancer and cardiovascular properties. Involved in the glucuronidation of the AGTR1 angiotensin receptor antagonist losartan, caderastan and zolarsatan, drugs which can inhibit the effect of angiotensin II ; [Isoform 2]: Lacks UGT glucuronidation activity but acts as a negative regulator of isoform 1.
• Tissue Specificity: Liver and colon . Isoform 1 and isoform 2 are expressed in colon, esophagus and small intestine; isoform 2 but not isoform 1 is expressed in liver or kidney .
• KEGG Pathway:
  Pentose and glucuro.te interconversions (hsa00040)
  Ascorbate and aldarate metabolism (hsa00053)
  Steroid hormone biosynthesis (hsa00140)
  Retinol metabolism (hsa00830)
  Porphyrin metabolism (hsa00860)
  Metabolism of xenobiotics by cytochrome P450 (hsa00980)
  Drug metabolism - cytochrome P450 (hsa00982)
  Drug metabolism - other enzymes (hsa00983)
  Metabolic pathways (hsa01100)
  Biosynthesis of cofactors (hsa01240)
  Bile secretion (hsa04976)
  Chemical carcinogenesis - D. adducts (hsa05204)
  Chemical carcinogenesis - receptor activation (hsa05207)
• Reactome Pathway:
  Paracetamol ADME (R-HSA-9753281)
  Glucuronidation (R-HSA-156588)

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Biotransformations of 58 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of Acetaminophen.	[20]
Estradiol	DMUNTE3	Approved	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of Estradiol.	[20]
Aspirin	DM672AH	Approved	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of Aspirin.	[20]
Diclofenac	DMPIHLS	Approved	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of Diclofenac.	[20]
Indomethacin	DMSC4A7	Approved	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of Indomethacin.	[20]
Sulindac	DM2QHZU	Approved	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of Sulindac.	[22]
Capsaicin	DMGMF6V	Approved	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of Capsaicin.	[23]
Ibuprofen	DM8VCBE	Approved	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of Ibuprofen.	[20]
Estrone	DM5T6US	Approved	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of Estrone.	[20]
Morphine	DMRMS0L	Approved	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of Morphine.	[25]
Estriol	DMOEM2I	Approved	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of Estriol.	[20]
Masoprocol	DMMVNZ0	Approved	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of Masoprocol.	[23]
Flurbiprofen	DMGN4BY	Approved	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of Flurbiprofen.	[20]
Mefenamic acid	DMK7HFI	Approved	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of Mefenamic acid.	[20]
Naproxen	DMZ5RGV	Approved	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of Naproxen.	[26]
Etodolac	DM6WJO9	Approved	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of Etodolac.	[26]
Aldosterone	DM9S2JW	Approved	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of Aldosterone.	[27]
Ketoprofen	DMRKXPT	Approved	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of Ketoprofen.	[26]
Salicyclic acid	DM2F8XZ	Approved	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of Salicyclic acid.	[20]
Furosemide	DMMQ8ZG	Approved	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of Furosemide.	[20]
Entacapone	DMLBVKQ	Approved	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of Entacapone.	[28]
Fenoprofen	DML5VQ0	Approved	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of Fenoprofen.	[20]
Diflunisal	DM7EN8I	Approved	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of Diflunisal.	[20]
Felbinac	DMKZEIB	Approved	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of Felbinac.	[20]
Resveratrol	DM3RWXL	Phase 3	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of Resveratrol.	[29]
Curcumin	DMQPH29	Phase 3	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of Curcumin.	[23]
EXISULIND	DMBY56U	Phase 3	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of EXISULIND.	[22]
Genistein	DM0JETC	Phase 2/3	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of Genistein.	[23]
Eugenol	DM7US1H	Patented	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of Eugenol.	[23]
T83193	DMHO29Y	Patented	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of T83193.	[20]
Steroid derivative 1	DMB0NVQ	Patented	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of Steroid derivative 1.	[20]
Ferulic Acid	DMJC7NF	Patented	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of Ferulic Acid.	[20]
INDOPROFEN	DM5QSKN	Withdrawn from market	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of INDOPROFEN.	[20]
EMODIN	DMAEDQG	Terminated	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of EMODIN.	[23]
Coumestrol	DM40TBU	Investigative	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of Coumestrol.	[23]
Arachidonic acid	DMUOQZD	Investigative	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of Arachidonic acid.	[31]
BRN-3548355	DM4KXT0	Investigative	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of BRN-3548355.	[32]
Chrysin	DM7V2LG	Investigative	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of Chrysin.	[23]
Daidzein	DMRFTJX	Investigative	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of Daidzein.	[23]
(E)-4-(3,5-dimethoxystyryl)phenol	DMYXI2V	Investigative	UDP-glucuronosyltransferase 1A10 affects the glucuronidation of (E)-4-(3,5-dimethoxystyryl)phenol.	[33]
Apigenin	DMI3491	Investigative	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of Apigenin.	[23]
biochanin A	DM0HPWY	Investigative	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of biochanin A.	[23]
3,7,3',4'-TETRAHYDROXYFLAVONE	DMES906	Investigative	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of 3,7,3',4'-TETRAHYDROXYFLAVONE.	[23]
Galangin	DM5TQ2O	Investigative	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of Galangin.	[23]
methyl salicylate	DMKCG8H	Investigative	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of methyl salicylate.	[20]
Plumbagin	DM9BS50	Investigative	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of Plumbagin.	[23]
Formononetin	DM7WFZ8	Investigative	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of Formononetin.	[23]
Mononitrophenol	DM4QO9G	Investigative	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of Mononitrophenol.	[28]
2-hydroxy-17beta-estradiol	DMM9Z0B	Investigative	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of 2-hydroxy-17beta-estradiol.	[20]
Fibrates	DMFNTMY	Investigative	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of Fibrates.	[20]
Cinnamic acid	DM340FH	Investigative	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of Cinnamic acid.	[20]
ACMC-1AKLT	DMRQ70X	Investigative	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of ACMC-1AKLT.	[34]
Hydroxyestrone	DMBO7ZD	Investigative	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of Hydroxyestrone.	[20]
BRN-1999480	DMC9Q4D	Investigative	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of BRN-1999480.	[20]
Anthraflavic acid	DMN1YFU	Investigative	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of Anthraflavic acid.	[23]
SCOPOLETIN	DM645FP	Investigative	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of SCOPOLETIN.	[28]
Quinizarin	DMRQCK3	Investigative	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of Quinizarin.	[23]
Diphenylacetic Acid	DMP6IHR	Investigative	UDP-glucuronosyltransferase 1A10 increases the glucuronidation of Diphenylacetic Acid.	[20]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Irinotecan	DMP6SC2	Approved	UDP-glucuronosyltransferase 1A10 decreases the activity of Irinotecan.	[21]

This DOT Affected the Regulation of Drug Effects of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Warfarin	DMJYCVW	Approved	UDP-glucuronosyltransferase 1A10 increases the metabolism of Warfarin.	[24]
Puerarin	DMJIMXH	Phase 2	UDP-glucuronosyltransferase 1A10 increases the metabolism of Puerarin.	[30]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of UDP-glucuronosyltransferase 1A10.	[1]
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the methylation of UDP-glucuronosyltransferase 1A10.	[5]

27 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Quercetin	DM3NC4M	Approved	Quercetin decreases the activity of UDP-glucuronosyltransferase 1A10.	[2]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of UDP-glucuronosyltransferase 1A10.	[3]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of UDP-glucuronosyltransferase 1A10.	[4]
Troglitazone	DM3VFPD	Approved	Troglitazone increases the expression of UDP-glucuronosyltransferase 1A10.	[6]
Omeprazole	DM471KJ	Approved	Omeprazole increases the expression of UDP-glucuronosyltransferase 1A10.	[7]
Osimertinib	DMRJLAT	Approved	Osimertinib decreases the activity of UDP-glucuronosyltransferase 1A10.	[8]
Doxycycline	DM7ICNU	Approved	Doxycycline increases the expression of UDP-glucuronosyltransferase 1A10.	[9]
Tucatinib	DMBESUA	Approved	Tucatinib decreases the activity of UDP-glucuronosyltransferase 1A10.	[10]
Opicapone	DM1BKA6	Approved	Opicapone decreases the activity of UDP-glucuronosyltransferase 1A10.	[11]
Canagliflozin	DMFRM1I	Approved	Canagliflozin decreases the activity of UDP-glucuronosyltransferase 1A10.	[12]
3,4-Dihydroxycinnamic Acid	DMVZL26	Phase 4	3,4-Dihydroxycinnamic Acid decreases the activity of UDP-glucuronosyltransferase 1A10.	[13]
BAICALEIN	DM4C7E6	Phase 2	BAICALEIN decreases the activity of UDP-glucuronosyltransferase 1A10.	[12]
LM-94	DMW3QGJ	Phase 1/2	LM-94 increases the activity of UDP-glucuronosyltransferase 1A10.	[14]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of UDP-glucuronosyltransferase 1A10.	[15]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of UDP-glucuronosyltransferase 1A10.	[16]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of UDP-glucuronosyltransferase 1A10.	[17]
Kaempferol	DMHEMUB	Investigative	Kaempferol decreases the activity of UDP-glucuronosyltransferase 1A10.	[2]
CATECHIN	DMY38SB	Investigative	CATECHIN decreases the activity of UDP-glucuronosyltransferase 1A10.	[13]
Myricetin	DMTV4L0	Investigative	Myricetin decreases the activity of UDP-glucuronosyltransferase 1A10.	[2]
Chlorogenic acid	DM2Y3P4	Investigative	Chlorogenic acid decreases the activity of UDP-glucuronosyltransferase 1A10.	[13]
Morin	DM2OGZ5	Investigative	Morin decreases the activity of UDP-glucuronosyltransferase 1A10.	[2]
Wogonin	DMGCF51	Investigative	Wogonin decreases the activity of UDP-glucuronosyltransferase 1A10.	[12]
P-Coumaric Acid	DMGJSVD	Investigative	P-Coumaric Acid decreases the activity of UDP-glucuronosyltransferase 1A10.	[13]
Phloretin	DMYA50U	Investigative	Phloretin decreases the activity of UDP-glucuronosyltransferase 1A10.	[13]
AMENTOFLAVONE	DMLRNV2	Investigative	AMENTOFLAVONE decreases the activity of UDP-glucuronosyltransferase 1A10.	[18]
pregnenolone-16alpha-carbonitrile	DM0LW7G	Investigative	pregnenolone-16alpha-carbonitrile increases the expression of UDP-glucuronosyltransferase 1A10.	[19]
Phlorizin	DMNARGO	Investigative	Phlorizin decreases the activity of UDP-glucuronosyltransferase 1A10.	[13]

References

• [1] Integrated 'omics analysis reveals new drug-induced mitochondrial perturbations in human hepatocytes. Toxicol Lett. 2018 Jun 1;289:1-13.
• [2] Potential interactions among myricetin and dietary flavonols through the inhibition of human UDP-glucuronosyltransferase in vitro. Toxicol Lett. 2022 Apr 1;358:40-47. doi: 10.1016/j.toxlet.2022.01.007. Epub 2022 Jan 19.
• [3] Gene microarray analysis of human renal cell carcinoma: the effects of HDAC inhibition and retinoid treatment. Cancer Biol Ther. 2008 Oct;7(10):1607-18.
• [4] UDP-glucuronosyltransferase 1A6 overexpression in breast cancer cells resistant to methotrexate. Biochem Pharmacol. 2011 Jan 1;81(1):60-70.
• [5] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [6] Species-specific toxicity of diclofenac and troglitazone in primary human and rat hepatocytes. Chem Biol Interact. 2009 Apr 15;179(1):17-24.
• [7] Use of mRNA expression to detect the induction of drug metabolising enzymes in rat and human hepatocytes. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):86-96.
• [8] In vitro inhibition of human UDP-glucuronosyltransferase (UGT) 1A1 by osimertinib, and prediction of in vivo drug-drug interactions. Toxicol Lett. 2021 Sep 15;348:10-17. doi: 10.1016/j.toxlet.2021.05.004. Epub 2021 May 24.
• [9] Aryl hydrocarbon receptor protects lung adenocarcinoma cells against cigarette sidestream smoke particulates-induced oxidative stress. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):293-301.
• [10] Drug-drug interaction potentials of tucatinib inhibition of human UDP-glucuronosyltransferases. Chem Biol Interact. 2023 Aug 25;381:110574. doi: 10.1016/j.cbi.2023.110574. Epub 2023 May 30.
• [11] In vitro effects of opicapone on activity of human UDP-glucuronosyltransferases isoforms. Toxicol Lett. 2022 Aug 15;367:3-8. doi: 10.1016/j.toxlet.2022.07.003. Epub 2022 Jul 8.
• [12] Evaluation of inhibitors of intestinal UDP-glucuronosyltransferases 1A8 and 1A10 using raloxifene as a substrate in Caco-2 cells: Studies with four flavonoids of Scutellaria baicalensis. Toxicol In Vitro. 2021 Apr;72:105087. doi: 10.1016/j.tiv.2021.105087. Epub 2021 Jan 10.
• [13] Phloretin exhibits potential food-drug interactions by inhibiting human UDP-glucuronosyltransferases in vitro. Toxicol In Vitro. 2022 Oct;84:105447. doi: 10.1016/j.tiv.2022.105447. Epub 2022 Jul 19.
• [14] Assessment of the inhibition potential of Licochalcone A against human UDP-glucuronosyltransferases. Food Chem Toxicol. 2016 Apr;90:112-22.
• [15] Altered gene expression patterns in MCF-7 cells induced by the urban dust particulate complex mixture standard reference material 1649a. Cancer Res. 2005 Feb 15;65(4):1251-8.
• [16] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [17] Bisphenol A-associated alterations in the expression and epigenetic regulation of genes encoding xenobiotic metabolizing enzymes in human fetal liver. Environ Mol Mutagen. 2014 Apr;55(3):184-95.
• [18] Amentoflavone is a potent broad-spectrum inhibitor of human UDP-glucuronosyltransferases. Chem Biol Interact. 2018 Mar 25;284:48-55.
• [19] Tissue-specific, inducible, and hormonal control of the human UDP-glucuronosyltransferase-1 (UGT1) locus. J Biol Chem. 2005 Nov 11;280(45):37547-57.
• [20] Gastrointestinally distributed UDP-glucuronosyltransferase 1A10, which metabolizes estrogens and nonsteroidal anti-inflammatory drugs, depends upon phosphorylation. J Biol Chem. 2004 Jul 2;279(27):28320-9. doi: 10.1074/jbc.M401396200. Epub 2004 Apr 26.
• [21] UGT1A10 is responsible for SN-38 glucuronidation and its expression in human lung cancers. Anticancer Res. 2004 Sep-Oct;24(5A):2893-6.
• [22] Glucuronidation of nonsteroidal anti-inflammatory drugs: identifying the enzymes responsible in human liver microsomes. Drug Metab Dispos. 2005 Jul;33(7):1027-35.
• [23] Differential and special properties of the major human UGT1-encoded gastrointestinal UDP-glucuronosyltransferases enhance potential to control chemical uptake. J Biol Chem. 2004 Jan 9;279(2):1429-41.
• [24] Assessing cytochrome P450 and UDP-glucuronosyltransferase contributions to warfarin metabolism in humans. Chem Res Toxicol. 2009 Jul;22(7):1239-45.
• [25] Isoform selectivity and kinetics of morphine 3- and 6-glucuronidation by human udp-glucuronosyltransferases: evidence for atypical glucuronidation kinetics by UGT2B7. Drug Metab Dispos. 2003 Sep;31(9):1086-9. doi: 10.1124/dmd.31.9.1086.
• [26] Carboxyl nonsteroidal anti-inflammatory drugs are efficiently glucuronidated by microsomes of the human gastrointestinal tract. Biochim Biophys Acta. 2004 Nov 18;1675(1-3):120-9. doi: 10.1016/j.bbagen.2004.08.013.
• [27] Aldosterone glucuronidation by human liver and kidney microsomes and recombinant UDP-glucuronosyltransferases: inhibition by NSAIDs. Br J Clin Pharmacol. 2009 Sep;68(3):402-12. doi: 10.1111/j.1365-2125.2009.03469.x.
• [28] Kinetic characterization of the 1A subfamily of recombinant human UDP-glucuronosyltransferases. Drug Metab Dispos. 2005 Jul;33(7):1017-26.
• [29] Resveratrol (trans-resveratrol, 3,5,4'-trihydroxy-trans-stilbene) glucuronidation exhibits atypical enzyme kinetics in various protein sources. Drug Metab Dispos. 2008 Feb;36(2):322-30. doi: 10.1124/dmd.107.018788. Epub 2007 Nov 8.
• [30] UDP-glucuronosyltransferase 1A1 is the principal enzyme responsible for puerarin metabolism in human liver microsomes. Arch Toxicol. 2012 Nov;86(11):1681-90. doi: 10.1007/s00204-012-0874-7. Epub 2012 May 31.
• [31] Glucuronidation of oxidized fatty acids and prostaglandins B1 and E2 by human hepatic and recombinant UDP-glucuronosyltransferases. J Lipid Res. 2004 Sep;45(9):1694-703. doi: 10.1194/jlr.M400103-JLR200. Epub 2004 Jul 1.
• [32] Prominent Stereoselectivity of NNAL Glucuronidation in Upper Aerodigestive Tract Tissues. Chem Res Toxicol. 2019 Aug 19;32(8):1689-1698. doi: 10.1021/acs.chemrestox.9b00217. Epub 2019 Jul 30.
• [33] Differences in the glucuronidation of resveratrol and pterostilbene: altered enzyme specificity and potential gender differences. Drug Metab Pharmacokinet. 2014;29(2):112-9. doi: 10.2133/dmpk.dmpk-13-rg-012. Epub 2013 Aug 20.
• [34] Phase II metabolism of betulin by rat and human UDP-glucuronosyltransferases and sulfotransferases. Chem Biol Interact. 2019 Apr 1;302:190-195. doi: 10.1016/j.cbi.2019.02.009. Epub 2019 Feb 15.