Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTP4I4DL)

• DOT Name: Coilin (COIL)
• Synonyms: p80-coilin
• Gene Name: COIL
• Related Disease:
  Melanocytic nevus
  Melanoma
  Spinocerebellar ataxia type 1
  Acute lymphocytic leukaemia
  Alzheimer disease
  Bone osteosarcoma
  Breast cancer
  Breast carcinoma
  Childhood acute lymphoblastic leukemia
  Choriocarcinoma
  Chromosomal disorder
  Huntington disease
  Leiomyosarcoma
  Leukemia
  Lymphoproliferative syndrome
  Malignant peripheral nerve sheath tumor
  Non-small-cell lung cancer
  Osteosarcoma
  Plasmodium vivax malaria
  Rhabdomyosarcoma
  Soft tissue neoplasm
  Spinal muscular atrophy
  Spinal muscular atrophy, type 1
  X-linked Opitz G/BBB syndrome
  Adult lymphoma
  Lymphoma
  Neoplasm
  Nervous system inflammation
  Pediatric lymphoma
  Rectal carcinoma
  Retinoblastoma
• UniProt ID: COIL_HUMAN
• Pfam ID: PF15862
• Sequence:
  MAASETVRLRLQFDYPPPATPHCTAFWLLVDLNRCRVVTDLISLIRQRFGFSSGAFLGLY
  LEGGLLPPAESARLVRDNDCLRVKLEERGVAENSVVISNGDINLSLRKAKKRAFQLEEGE
  ETEPDCKYSKKHWKSRENNNNNEKVLDLEPKAVTDQTVSKKNKRKNKATCGTVGDDNEEA
  KRKSPKKKEKCEYKKKAKNPKSPKVQAVKDWANQRCSSPKGSARNSLVKAKRKGSVSVCS
  KESPSSSSESESCDESISDGPSKVTLEARNSSEKLPTELSKEEPSTKNTTADKLAIKLGF
  SLTPSKGKTSGTTSSSSDSSAESDDQCLMSSSTPECAAGFLKTVGLFAGRGRPGPGLSSQ
  TAGAAGWRRSGSNGGGQAPGASPSVSLPASLGRGWGREENLFSWKGAKGRGMRGRGRGRG
  HPVSCVVNRSTDNQRQQQLNDVVKNSSTIIQNPVETPKKDYSLLPLLAAAPQVGEKIAFK
  LLELTSSYSPDVSDYKEGRILSHNPETQQVDIEILSSLPALREPGKFDLVYHNENGAEVV
  EYAVTQESKITVFWKELIDPRLIIESPSNTSSTEPA
• Function: Component of nuclear coiled bodies, also known as Cajal bodies or CBs, which are involved in the modification and assembly of nucleoplasmic snRNPs.
• Tissue Specificity: Found in all the cell types examined.

Molecular Interaction Atlas (MIA) of This DOT

31 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Melanocytic nevus	DISYS32D	Definitive	Biomarker	[1]
Melanoma	DIS1RRCY	Definitive	Biomarker	[1]
Spinocerebellar ataxia type 1	DISF7BO2	Definitive	Biomarker	[2]
Acute lymphocytic leukaemia	DISPX75S	Strong	Biomarker	[3]
Alzheimer disease	DISF8S70	Strong	Biomarker	[4]
Bone osteosarcoma	DIST1004	Strong	Biomarker	[5]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[6]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[6]
Childhood acute lymphoblastic leukemia	DISJ5D6U	Strong	Biomarker	[3]
Choriocarcinoma	DISDBVNL	Strong	Altered Expression	[7]
Chromosomal disorder	DISM5BB5	Strong	Genetic Variation	[8]
Huntington disease	DISQPLA4	Strong	Biomarker	[9]
Leiomyosarcoma	DIS6COXM	Strong	Biomarker	[10]
Leukemia	DISNAKFL	Strong	Biomarker	[11]
Lymphoproliferative syndrome	DISMVL8O	Strong	Biomarker	[12]
Malignant peripheral nerve sheath tumor	DIS0JTN6	Strong	Altered Expression	[10]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[13]
Osteosarcoma	DISLQ7E2	Strong	Biomarker	[5]
Plasmodium vivax malaria	DISPU3H9	Strong	Biomarker	[14]
Rhabdomyosarcoma	DISNR7MS	Strong	Altered Expression	[10]
Soft tissue neoplasm	DISP2OHE	Strong	Biomarker	[10]
Spinal muscular atrophy	DISTLKOB	Strong	Biomarker	[15]
Spinal muscular atrophy, type 1	DISYCWUG	Strong	Biomarker	[16]
X-linked Opitz G/BBB syndrome	DISQ14EC	Disputed	Genetic Variation	[17]
Adult lymphoma	DISK8IZR	Limited	Biomarker	[18]
Lymphoma	DISN6V4S	Limited	Genetic Variation	[18]
Neoplasm	DISZKGEW	Limited	Biomarker	[19]
Nervous system inflammation	DISB3X5A	Limited	Biomarker	[20]
Pediatric lymphoma	DIS51BK2	Limited	Biomarker	[18]
Rectal carcinoma	DIS8FRR7	Limited	Genetic Variation	[21]
Retinoblastoma	DISVPNPB	Limited	Biomarker	[22]

14 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Coilin (COIL).	[23]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Coilin (COIL).	[24]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Coilin (COIL).	[25]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Coilin (COIL).	[26]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Coilin (COIL).	[27]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Coilin (COIL).	[28]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Coilin (COIL).	[29]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Coilin (COIL).	[30]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Coilin (COIL).	[31]
Camptothecin	DM6CHNJ	Phase 3	Camptothecin increases the expression of Coilin (COIL).	[32]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Coilin (COIL).	[36]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Coilin (COIL).	[37]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Coilin (COIL).	[38]
DZNep	DM0JXBK	Investigative	DZNep increases the expression of Coilin (COIL).	[32]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Coilin (COIL).	[33]
TAK-243	DM4GKV2	Phase 1	TAK-243 decreases the sumoylation of Coilin (COIL).	[34]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Coilin (COIL).	[35]
Coumarin	DM0N8ZM	Investigative	Coumarin increases the phosphorylation of Coilin (COIL).	[35]

References

• [1] FT-IR Spectroscopy Study in Early Diagnosis of Skin Cancer.In Vivo. 2017 Nov-Dec;31(6):1131-1137. doi: 10.21873/invivo.11179.
• [2] p80 coilin, a coiled body-specific protein, interacts with ataxin-1, the SCA1 gene product.Biochim Biophys Acta. 2003 May 20;1638(1):35-42. doi: 10.1016/s0925-4439(03)00038-3.
• [3] The prognostic potential of coilin in association with p27 expression in pediatric acute lymphoblastic leukemia for disease relapse.Cancer Cell Int. 2018 Jul 27;18:106. doi: 10.1186/s12935-018-0600-5. eCollection 2018.
• [4] Expression of DNA excision-repair-cross-complementing proteins p80 and p89 in brain of patients with Down Syndrome and Alzheimer's disease.Neurosci Lett. 1998 Jul 17;251(1):45-8. doi: 10.1016/s0304-3940(98)00488-1.
• [5] Cell surface expression of epidermal growth factor receptor and Her-2 with nuclear expression of Her-4 in primary osteosarcoma.Cancer Res. 2004 Mar 15;64(6):2047-53. doi: 10.1158/0008-5472.can-03-3096.
• [6] Katanin P80 expression correlates with lymph node metastasis and worse overall survival in patients with breast cancer.Cancer Biomark. 2018;23(3):363-371. doi: 10.3233/CBM-181369.
• [7] Molecular, biochemical, and functional characteristics of tumor necrosis factor-alpha produced by human placental cytotrophoblastic cells.J Immunol. 1993 Jun 15;150(12):5614-24.
• [8] Malignant histiocytosis. Histologic, cytochemical, chromosomal, and molecular data with a nosologic discussion.Hematol Oncol Clin North Am. 1998 Apr;12(2):445-63. doi: 10.1016/s0889-8588(05)70522-0.
• [9] PRMT5- mediated symmetric arginine dimethylation is attenuated by mutant huntingtin and is impaired in Huntington's disease (HD).Cell Cycle. 2015;14(11):1716-29. doi: 10.1080/15384101.2015.1033595.
• [10] Expression of ALK1 and p80 in inflammatory myofibroblastic tumor and its mesenchymal mimics: a study of 135 cases.Mod Pathol. 2002 Sep;15(9):931-8. doi: 10.1097/01.MP.0000026615.04130.1F.
• [11] Interactions between coilin and PIASy partially link Cajal bodies to PML bodies.J Cell Sci. 2005 Nov 1;118(Pt 21):4995-5003. doi: 10.1242/jcs.02613. Epub 2005 Oct 11.
• [12] The t(2;5)-associated p80 NPM/ALK fusion protein in nodal and cutaneous CD30+ lymphoproliferative disorders.J Cutan Pathol. 1997 Nov;24(10):597-603. doi: 10.1111/j.1600-0560.1997.tb01090.x.
• [13] The clinical significance of transforming acidic coiled-coil protein 3 expression in non-small cell lung cancer.Oncol Rep. 2016 Jan;35(1):436-46. doi: 10.3892/or.2015.4373. Epub 2015 Nov 2.
• [14] Natural immune response to Plasmodium vivax alpha-helical coiled coil protein motifs and its association with the risk of P. vivax malaria.PLoS One. 2017 Jun 26;12(6):e0179863. doi: 10.1371/journal.pone.0179863. eCollection 2017.
• [15] Coilin forms the bridge between Cajal bodies and SMN, the spinal muscular atrophy protein.Genes Dev. 2001 Oct 15;15(20):2720-9. doi: 10.1101/gad.908401.
• [16] Reorganization of Cajal bodies and nucleolar targeting of coilin in motor neurons of type I spinal muscular atrophy.Histochem Cell Biol. 2012 May;137(5):657-67. doi: 10.1007/s00418-012-0921-8. Epub 2012 Feb 1.
• [17] New mutations in MID1 provide support for loss of function as the cause of X-linked Opitz syndrome. Hum Mol Genet. 2000 Oct 12;9(17):2553-62. doi: 10.1093/hmg/9.17.2553.
• [18] Diagnosis of t(2;5)(p23;q35)-associated Ki-1 lymphoma with immunohistochemistry.Blood. 1994 Dec 1;84(11):3648-52.
• [19] Primary anaplastic large cell lymphoma of the small intestine.Am J Clin Pathol. 1999 Nov;112(5):696-701. doi: 10.1093/ajcp/112.5.696.
• [20] Treatment with soluble tumor necrosis factor receptor (sTNFR):Fc/p80 fusion protein ameliorates relapsing-remitting experimental autoimmune encephalomyelitis and decreases chemokine expression.Autoimmunity. 2004 Sep-Nov;37(6-7):465-71. doi: 10.1080/08916930400001859.
• [21] Sphincter-saving proctectomy for rectal cancer with NO COIL transanal tube and without ostoma. Clinical outcomes, cost effectiveness and quality of life in the elderly.Minerva Chir. 2019 Feb;74(1):19-25. doi: 10.23736/S0026-4733.18.07755-6. Epub 2018 Apr 13.
• [22] RB1CC1-enhanced autophagy facilitates PSCs activation and pancreatic fibrogenesis in chronic pancreatitis.Cell Death Dis. 2018 Sep 20;9(10):952. doi: 10.1038/s41419-018-0980-4.
• [23] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [24] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [25] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [26] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [27] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [28] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [29] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [30] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [31] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [32] Development and validation of the TGx-HDACi transcriptomic biomarker to detect histone deacetylase inhibitors in human TK6 cells. Arch Toxicol. 2021 May;95(5):1631-1645. doi: 10.1007/s00204-021-03014-2. Epub 2021 Mar 26.
• [33] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [34] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [35] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [36] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [37] Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
• [38] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.