Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTTGAEJE)

• DOT Name: CAP-Gly domain-containing linker protein 1 (CLIP1)
• Synonyms: Cytoplasmic linker protein 1; Cytoplasmic linker protein 170 alpha-2; CLIP-170; Reed-Sternberg intermediate filament-associated protein; Restin
• Gene Name: CLIP1
• Related Disease:
  Classic Hodgkin lymphoma
  Ovarian neoplasm
  Advanced cancer
  AIDS-related lymphoma
  Anaplastic large cell lymphoma
  Autism
  Autism spectrum disorder
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Hepatitis B virus infection
  Hepatocellular carcinoma
  Kaposi sarcoma
  Myotonic dystrophy
  Neoplasm
  Carcinoma of liver and intrahepatic biliary tract
  Liver cancer
  Autosomal recessive non-syndromic intellectual disability
  Metastatic malignant neoplasm
  Craniodiaphyseal dysplasia
  Craniodiaphyseal dysplasia, autosomal dominant
  Developmental and epileptic encephalopathy, 2
  Hepatitis C virus infection
  Intellectual disability
  Type-1 diabetes
• UniProt ID: CLIP1_HUMAN
• PDB ID: 2CP5; 2CP6; 2E3H; 2E3I; 2E4H; 2HQH; 2QK0; 3E2U; 3RDV
• Pfam ID: PF01302 ; PF16641
• Sequence:
  MSMLKPSGLKAPTKILKPGSTALKTPTAVVAPVEKTISSEKASSTPSSETQEEFVDDFRV
  GERVWVNGNKPGFIQFLGETQFAPGQWAGIVLDEPIGKNDGSVAGVRYFQCEPLKGIFTR
  PSKLTRKVQAEDEANGLQTTPASRATSPLCTSTASMVSSSPSTPSNIPQKPSQPAAKEPS
  ATPPISNLTKTASESISNLSEAGSIKKGERELKIGDRVLVGGTKAGVVRFLGETDFAKGE
  WCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGFPSTTPAKAKANAVRRVM
  ATTSASLKRSPSASSLSSMSSVASSVSSRPSRTGLLTETSSRYARKISGTTALQEALKEK
  QQHIEQLLAERDLERAEVAKATSHVGEIEQELALARDGHDQHVLELEAKMDQLRTMVEAA
  DREKVELLNQLEEEKRKVEDLQFRVEEESITKGDLEQKSQISEDPENTQTKLEHARIKEL
  EQSLLFEKTKADKLQRELEDTRVATVSEKSRIMELEKDLALRVQEVAELRRRLESNKPAG
  DVDMSLSLLQEISSLQEKLEVTRTDHQREITSLKEHFGAREETHQKEIKALYTATEKLSK
  ENESLKSKLEHANKENSDVIALWKSKLETAIASHQQAMEELKVSFSKGLGTETAEFAELK
  TQIEKMRLDYQHEIENLQNQQDSERAAHAKEMEALRAKLMKVIKEKENSLEAIRSKLDKA
  EDQHLVEMEDTLNKLQEAEIKVKELEVLQAKCNEQTKVIDNFTSQLKATEEKLLDLDALR
  KASSEGKSEMKKLRQQLEAAEKQIKHLEIEKNAESSKASSITRELQGRELKLTNLQENLS
  EVSQVKETLEKELQILKEKFAEASEEAVSVQRSMQETVNKLHQKEEQFNMLSSDLEKLRE
  NLADMEAKFREKDEREEQLIKAKEKLENDIAEIMKMSGDNSSQLTKMNDELRLKERDVEE
  LQLKLTKANENASFLQKSIEDMTVKAEQSQQEAAKKHEEEKKELERKLSDLEKKMETSHN
  QCQELKARYERATSETKTKHEEILQNLQKTLLDTEDKLKGAREENSGLLQELEELRKQAD
  KAKAAQTAEDAMQIMEQMTKEKTETLASLEDTKQTNAKLQNELDTLKENNLKNVEELNKS
  KELLTVENQKMEEFRKEIETLKQAAAQKSQQLSALQEENVKLAEELGRSRDEVTSHQKLE
  EERSVLNNQLLEMKKRESKFIKDADEEKASLQKSISITSALLTEKDAELEKLRNEVTVLR
  GENASAKSLHSVVQTLESDKVKLELKVKNLELQLKENKRQLSSSSGNTDTQADEDERAQE
  SQIDFLNSVIVDLQRKNQDLKMKVEMMSEAALNGNGDDLNNYDSDDQEKQSKKKPRLFCD
  ICDCFDLHDTEDCPTQAQMSEDPPHSTHHGSRGEERPYCEICEMFGHWATNCNDDETF
• Function: Binds to the plus end of microtubules and regulates the dynamics of the microtubule cytoskeleton. Promotes microtubule growth and microtubule bundling. Links cytoplasmic vesicles to microtubules and thereby plays an important role in intracellular vesicle trafficking. Plays a role macropinocytosis and endosome trafficking.
• Tissue Specificity: Detected in dendritic cells (at protein level). Highly expressed in the Reed-Sternberg cells of Hodgkin disease.
• KEGG Pathway: mTOR sig.ling pathway (hsa04150)
• Reactome Pathway:
  Separation of Sister Chromatids (R-HSA-2467813)
  Resolution of Sister Chromatid Cohesion (R-HSA-2500257)
  RHO GTPases activate IQGAPs (R-HSA-5626467)
  RHO GTPases Activate Formins (R-HSA-5663220)
  Mitotic Prometaphase (R-HSA-68877)
  EML4 and NUDC in mitotic spindle formation (R-HSA-9648025)
  Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal (R-HSA-141444)

Molecular Interaction Atlas (MIA) of This DOT

25 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Classic Hodgkin lymphoma	DISV1LU6	Definitive	Biomarker	[1]
Ovarian neoplasm	DISEAFTY	Definitive	Biomarker	[2]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[3]
AIDS-related lymphoma	DISSLRAU	Strong	Biomarker	[4]
Anaplastic large cell lymphoma	DISP4D1R	Strong	Altered Expression	[5]
Autism	DISV4V1Z	Strong	Biomarker	[6]
Autism spectrum disorder	DISXK8NV	Strong	Biomarker	[6]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[7]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[7]
Breast neoplasm	DISNGJLM	Strong	Altered Expression	[8]
Hepatitis B virus infection	DISLQ2XY	Strong	Genetic Variation	[9]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[10]
Kaposi sarcoma	DISC1H1Z	Strong	Biomarker	[11]
Myotonic dystrophy	DISNBEMX	Strong	Altered Expression	[12]
Neoplasm	DISZKGEW	Strong	Biomarker	[13]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	moderate	Biomarker	[14]
Liver cancer	DISDE4BI	moderate	Biomarker	[14]
Autosomal recessive non-syndromic intellectual disability	DISJWRZZ	Supportive	Autosomal recessive	[15]
Metastatic malignant neoplasm	DIS86UK6	Disputed	Altered Expression	[7]
Craniodiaphyseal dysplasia	DIST8T27	Limited	Biomarker	[16]
Craniodiaphyseal dysplasia, autosomal dominant	DIS2YXJ1	Limited	Biomarker	[16]
Developmental and epileptic encephalopathy, 2	DISTFDNW	Limited	Biomarker	[16]
Hepatitis C virus infection	DISQ0M8R	Limited	Biomarker	[17]
Intellectual disability	DISMBNXP	Limited	Autosomal recessive	[18]
Type-1 diabetes	DIS7HLUB	Limited	Biomarker	[19]

6 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of CAP-Gly domain-containing linker protein 1 (CLIP1).	[20]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of CAP-Gly domain-containing linker protein 1 (CLIP1).	[34]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the phosphorylation of CAP-Gly domain-containing linker protein 1 (CLIP1).	[36]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of CAP-Gly domain-containing linker protein 1 (CLIP1).	[38]
Coumarin	DM0N8ZM	Investigative	Coumarin decreases the phosphorylation of CAP-Gly domain-containing linker protein 1 (CLIP1).	[36]
Hexadecanoic acid	DMWUXDZ	Investigative	Hexadecanoic acid decreases the phosphorylation of CAP-Gly domain-containing linker protein 1 (CLIP1).	[43]

20 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of CAP-Gly domain-containing linker protein 1 (CLIP1).	[21]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of CAP-Gly domain-containing linker protein 1 (CLIP1).	[22]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of CAP-Gly domain-containing linker protein 1 (CLIP1).	[23]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of CAP-Gly domain-containing linker protein 1 (CLIP1).	[24]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of CAP-Gly domain-containing linker protein 1 (CLIP1).	[25]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of CAP-Gly domain-containing linker protein 1 (CLIP1).	[26]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of CAP-Gly domain-containing linker protein 1 (CLIP1).	[27]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of CAP-Gly domain-containing linker protein 1 (CLIP1).	[28]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of CAP-Gly domain-containing linker protein 1 (CLIP1).	[29]
Menadione	DMSJDTY	Approved	Menadione affects the expression of CAP-Gly domain-containing linker protein 1 (CLIP1).	[30]
Cocaine	DMSOX7I	Approved	Cocaine increases the expression of CAP-Gly domain-containing linker protein 1 (CLIP1).	[31]
Clorgyline	DMCEUJD	Approved	Clorgyline increases the expression of CAP-Gly domain-containing linker protein 1 (CLIP1).	[32]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of CAP-Gly domain-containing linker protein 1 (CLIP1).	[33]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of CAP-Gly domain-containing linker protein 1 (CLIP1).	[35]
Geldanamycin	DMS7TC5	Discontinued in Phase 2	Geldanamycin increases the expression of CAP-Gly domain-containing linker protein 1 (CLIP1).	[37]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of CAP-Gly domain-containing linker protein 1 (CLIP1).	[39]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of CAP-Gly domain-containing linker protein 1 (CLIP1).	[40]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of CAP-Gly domain-containing linker protein 1 (CLIP1).	[41]
GALLICACID	DM6Y3A0	Investigative	GALLICACID decreases the expression of CAP-Gly domain-containing linker protein 1 (CLIP1).	[42]
Bilirubin	DMI0V4O	Investigative	Bilirubin decreases the expression of CAP-Gly domain-containing linker protein 1 (CLIP1).	[44]

References

• [1] Hodgkin and Reed-Sternberg cell-associated autoantigen CLIP-170/restin is a marker for dendritic cells and is involved in the trafficking of macropinosomes to the cytoskeleton, supporting a function-based concept of Hodgkin and Reed-Sternberg cells.Blood. 2002 Dec 1;100(12):4139-45. doi: 10.1182/blood.V100.12.4139.
• [2] Profiling follicle stimulating hormone-induced gene expression changes in normal and malignant human ovarian surface epithelial cells.Oncogene. 2003 Jul 3;22(27):4243-56. doi: 10.1038/sj.onc.1206437.
• [3] A Distributed Classifier for MicroRNA Target Prediction with Validation Through TCGA Expression Data.IEEE/ACM Trans Comput Biol Bioinform. 2018 Jul-Aug;15(4):1037-1051. doi: 10.1109/TCBB.2018.2828305. Epub 2018 Apr 19.
• [4] Ago HITS-CLIP expands understanding of Kaposi's sarcoma-associated herpesvirus miRNA function in primary effusion lymphomas. PLoS Pathog. 2012;8(8):e1002884.
• [5] Restin in Hodgkin's disease and anaplastic large cell lymphoma.Leuk Lymphoma. 1993 Dec;12(1-2):21-6. doi: 10.3109/10428199309059567.
• [6] Imbalance of Functional Connectivity and Temporal Entropy in Resting-State Networks in Autism Spectrum Disorder: A Machine Learning Approach.Front Neurosci. 2018 Nov 27;12:869. doi: 10.3389/fnins.2018.00869. eCollection 2018.
• [7] Restin suppressed epithelial-mesenchymal transition and tumor metastasis in breast cancer cells through upregulating mir-200a/b expression via association with p73.Mol Cancer. 2015 May 14;14:102. doi: 10.1186/s12943-015-0370-9.
• [8] Regulation of tumor angiogenesis by the microtubule-binding protein CLIP-170.Protein Cell. 2013 Apr;4(4):266-76. doi: 10.1007/s13238-013-3007-z. Epub 2013 Apr 3.
• [9] Monitoring the emergence of hepatitis B virus polymerase gene variants during lamivudine therapy in human immunodeficiency virus coinfected patients: performance of CLIP sequencing and line probe assay.Antivir Ther. 2003 Dec;8(6):627-34.
• [10] A combination of -fetoprotein, midkine, thioredoxin and a metabolite for predicting hepatocellular carcinoma.Ann Hepatol. 2020 Mar-Apr;19(2):179-185. doi: 10.1016/j.aohep.2019.09.002. Epub 2019 Oct 1.
• [11] HITS-CLIP analysis uncovers a link between the Kaposi's sarcoma-associated herpesvirus ORF57 protein and host pre-mRNA metabolism.PLoS Pathog. 2015 Feb 24;11(2):e1004652. doi: 10.1371/journal.ppat.1004652. eCollection 2015 Feb.
• [12] MBNL Sequestration by Toxic RNAs and RNA Misprocessing in the Myotonic Dystrophy Brain.Cell Rep. 2015 Aug 18;12(7):1159-68. doi: 10.1016/j.celrep.2015.07.029. Epub 2015 Aug 6.
• [13] Clinical, histopathologic, and genomic features of Spitz tumors with ALK fusions.Am J Surg Pathol. 2015 May;39(5):581-91. doi: 10.1097/PAS.0000000000000387.
• [14] The Munich-Transarterial Chemoembolisation Score Holds Superior Prognostic Capacities Compared to TACE-Tailored Modifications of 9 Established Staging Systems for Hepatocellular Carcinoma.Digestion. 2019;100(1):15-26. doi: 10.1159/000493136. Epub 2018 Oct 3.
• [15] A defect in the CLIP1 gene (CLIP-170) can cause autosomal recessive intellectual disability. Eur J Hum Genet. 2015 Mar;23(3):331-6. doi: 10.1038/ejhg.2014.13. Epub 2014 Feb 26.
• [16] Pregnenolone and pregnenolone-methyl-ether rescue neuronal defects caused by dysfunctional CLIP170 in a neuronal model of CDKL5 Deficiency Disorder.Neuropharmacology. 2020 Mar 1;164:107897. doi: 10.1016/j.neuropharm.2019.107897. Epub 2019 Nov 30.
• [17] Towards a better resolution of hepatitis C virus variants: CLIP sequencing of an HCV core fragment and automated assignment of genotypes and subtypes.J Virol Methods. 2008 Mar;148(1-2):25-33. doi: 10.1016/j.jviromet.2007.10.012. Epub 2007 Nov 28.
• [18] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [19] On the perils of poor editing: regulation of peptide loading by HLA-DQ and H2-A molecules associated with celiac disease and type 1 diabetes.Expert Rev Mol Med. 2012 Jul 6;14:e15. doi: 10.1017/erm.2012.9.
• [20] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [21] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [22] Transcriptional up-regulation of restin by all-trans retinoic acid through STAT1 in cancer cell differentiation process. Biochem Biophys Res Commun. 2006 May 19;343(4):1009-16. doi: 10.1016/j.bbrc.2006.02.176. Epub 2006 Mar 9.
• [23] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [24] Gamma-irradiation and doxorubicin treatment of normal human cells cause cell cycle arrest via different pathways. Mol Cells. 2005 Dec 31;20(3):331-8.
• [25] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [26] High-throughput ectopic expression screen for tamoxifen resistance identifies an atypical kinase that blocks autophagy. Proc Natl Acad Sci U S A. 2011 Feb 1;108(5):2058-63.
• [27] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [28] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [29] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [30] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [31] Gene expression in human hippocampus from cocaine abusers identifies genes which regulate extracellular matrix remodeling. PLoS One. 2007 Nov 14;2(11):e1187. doi: 10.1371/journal.pone.0001187.
• [32] Anti-oncogenic and pro-differentiation effects of clorgyline, a monoamine oxidase A inhibitor, on high grade prostate cancer cells. BMC Med Genomics. 2009 Aug 20;2:55. doi: 10.1186/1755-8794-2-55.
• [33] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [34] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [35] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [36] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [37] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [38] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [39] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [40] Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
• [41] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [42] Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.
• [43] Functional lipidomics: Palmitic acid impairs hepatocellular carcinoma development by modulating membrane fluidity and glucose metabolism. Hepatology. 2017 Aug;66(2):432-448. doi: 10.1002/hep.29033. Epub 2017 Jun 16.
• [44] Global changes in gene regulation demonstrate that unconjugated bilirubin is able to upregulate and activate select components of the endoplasmic reticulum stress response pathway. J Biochem Mol Toxicol. 2010 Mar-Apr;24(2):73-88.