Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTVAZOHC)

• DOT Name: Coronin-1A (CORO1A)
• Synonyms: Coronin-like protein A; Clipin-A; Coronin-like protein p57; Tryptophan aspartate-containing coat protein; TACO
• Gene Name: CORO1A
• Related Disease:
  Severe combined immunodeficiency due to CORO1A deficiency
  Adenocarcinoma
  Advanced cancer
  Alzheimer disease
  B-cell lymphoma
  Beckwith-Wiedemann syndrome
  Breast neoplasm
  Colon cancer
  Colon carcinoma
  Complete hydatidiform mole
  Gastric cancer
  Hepatocellular carcinoma
  Hydatidiform mole
  Hydatidiform mole, recurrent, 1
  Insulinoma
  Lupus
  Omenn syndrome
  Severe combined immunodeficiency
  Stomach cancer
  Systemic lupus erythematosus
  Thyroid gland carcinoma
  Thyroid tumor
  Colorectal carcinoma
  Epidermodysplasia verruciformis
  High blood pressure
  Immunodeficiency
  Meningioma
  Squamous cell carcinoma
  Adult lymphoma
  Lymphoma
  Pediatric lymphoma
  Acute lymphocytic leukaemia
  Acute myelogenous leukaemia
  Attention deficit hyperactivity disorder
  Autism spectrum disorder
  Bone osteosarcoma
  Carcinoma
  Childhood acute lymphoblastic leukemia
  Clear cell renal carcinoma
  Epithelial ovarian cancer
  Osteosarcoma
  Ovarian cancer
  Ovarian neoplasm
  Renal cell carcinoma
  Tuberculosis
  Wilms tumor
• UniProt ID: COR1A_HUMAN
• Pfam ID: PF08953 ; PF08954 ; PF00400 ; PF16300
• Sequence:
  MSRQVVRSSKFRHVFGQPAKADQCYEDVRVSQTTWDSGFCAVNPKFVALICEASGGGAFL
  VLPLGKTGRVDKNAPTVCGHTAPVLDIAWCPHNDNVIASGSEDCTVMVWEIPDGGLMLPL
  REPVVTLEGHTKRVGIVAWHTTAQNVLLSAGCDNVIMVWDVGTGAAMLTLGPEVHPDTIY
  SVDWSRDGGLICTSCRDKRVRIIEPRKGTVVAEKDRPHEGTRPVRAVFVSEGKILTTGFS
  RMSERQVALWDTKHLEEPLSLQELDTSSGVLLPFFDPDTNIVYLCGKGDSSIRYFEITSE
  APFLHYLSMFSSKESQRGMGYMPKRGLEVNKCEIARFYKLHERRCEPIAMTVPRKSDLFQ
  EDLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSRELRVNRGLDTGRRRAAPE
  ASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK
• Function: May be a crucial component of the cytoskeleton of highly motile cells, functioning both in the invagination of large pieces of plasma membrane, as well as in forming protrusions of the plasma membrane involved in cell locomotion. In mycobacteria-infected cells, its retention on the phagosomal membrane prevents fusion between phagosomes and lysosomes.
• Tissue Specificity: Expressed in brain, thymus, spleen, bone marrow and lymph node. Low in lung and gut.
• KEGG Pathway:
  Phagosome (hsa04145)
  Tuberculosis (hsa05152)
• Reactome Pathway: Prevention of phagosomal-lysosomal fusion (R-HSA-9636383)

Molecular Interaction Atlas (MIA) of This DOT

46 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Severe combined immunodeficiency due to CORO1A deficiency	DIS61XS7	Definitive	Autosomal recessive	[1]
Adenocarcinoma	DIS3IHTY	Strong	Altered Expression	[2]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[3]
Alzheimer disease	DISF8S70	Strong	Biomarker	[4]
B-cell lymphoma	DISIH1YQ	Strong	Biomarker	[5]
Beckwith-Wiedemann syndrome	DISH15GR	Strong	Posttranslational Modification	[6]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[7]
Colon cancer	DISVC52G	Strong	Altered Expression	[8]
Colon carcinoma	DISJYKUO	Strong	Altered Expression	[8]
Complete hydatidiform mole	DIS5QPI0	Strong	Genetic Variation	[9]
Gastric cancer	DISXGOUK	Strong	Biomarker	[10]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[11]
Hydatidiform mole	DISKNP7O	Strong	Genetic Variation	[12]
Hydatidiform mole, recurrent, 1	DISXUJWE	Strong	Genetic Variation	[12]
Insulinoma	DISIU1JS	Strong	Genetic Variation	[13]
Lupus	DISOKJWA	Strong	Biomarker	[14]
Omenn syndrome	DIS2C887	Strong	Biomarker	[15]
Severe combined immunodeficiency	DIS6MF4Q	Strong	Biomarker	[16]
Stomach cancer	DISKIJSX	Strong	Biomarker	[10]
Systemic lupus erythematosus	DISI1SZ7	Strong	Biomarker	[14]
Thyroid gland carcinoma	DISMNGZ0	Strong	Altered Expression	[17]
Thyroid tumor	DISLVKMD	Strong	Altered Expression	[17]
Colorectal carcinoma	DIS5PYL0	moderate	Biomarker	[18]
Epidermodysplasia verruciformis	DIS54WBS	Moderate	Autosomal recessive	[19]
High blood pressure	DISY2OHH	moderate	Biomarker	[20]
Immunodeficiency	DIS093I0	moderate	Genetic Variation	[21]
Meningioma	DISPT4TG	moderate	Altered Expression	[22]
Squamous cell carcinoma	DISQVIFL	moderate	Altered Expression	[23]
Adult lymphoma	DISK8IZR	Disputed	Biomarker	[24]
Lymphoma	DISN6V4S	Disputed	Altered Expression	[24]
Pediatric lymphoma	DIS51BK2	Disputed	Biomarker	[24]
Acute lymphocytic leukaemia	DISPX75S	Limited	Posttranslational Modification	[25]
Acute myelogenous leukaemia	DISCSPTN	Limited	Posttranslational Modification	[25]
Attention deficit hyperactivity disorder	DISL8MX9	Limited	Genetic Variation	[15]
Autism spectrum disorder	DISXK8NV	Limited	Autosomal dominant	[26]
Bone osteosarcoma	DIST1004	Limited	Altered Expression	[27]
Carcinoma	DISH9F1N	Limited	Biomarker	[28]
Childhood acute lymphoblastic leukemia	DISJ5D6U	Limited	Posttranslational Modification	[25]
Clear cell renal carcinoma	DISBXRFJ	Limited	Altered Expression	[29]
Epithelial ovarian cancer	DIS56MH2	Limited	Altered Expression	[30]
Osteosarcoma	DISLQ7E2	Limited	Altered Expression	[27]
Ovarian cancer	DISZJHAP	Limited	Altered Expression	[30]
Ovarian neoplasm	DISEAFTY	Limited	Altered Expression	[30]
Renal cell carcinoma	DISQZ2X8	Limited	Altered Expression	[29]
Tuberculosis	DIS2YIMD	Limited	Biomarker	[31]
Wilms tumor	DISB6T16	Limited	Biomarker	[32]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Coronin-1A (CORO1A).	[33]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Coronin-1A (CORO1A).	[37]

14 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Coronin-1A (CORO1A).	[34]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Coronin-1A (CORO1A).	[35]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Coronin-1A (CORO1A).	[36]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Coronin-1A (CORO1A).	[38]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Coronin-1A (CORO1A).	[39]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Coronin-1A (CORO1A).	[40]
Chenodiol	DMQ8JIK	Approved	Chenodiol decreases the expression of Coronin-1A (CORO1A).	[41]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene increases the expression of Coronin-1A (CORO1A).	[42]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Coronin-1A (CORO1A).	[43]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Coronin-1A (CORO1A).	[44]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Coronin-1A (CORO1A).	[45]
Deguelin	DMXT7WG	Investigative	Deguelin decreases the expression of Coronin-1A (CORO1A).	[46]
AHPN	DM8G6O4	Investigative	AHPN increases the expression of Coronin-1A (CORO1A).	[47]
Butanoic acid	DMTAJP7	Investigative	Butanoic acid increases the expression of Coronin-1A (CORO1A).	[48]

References

• [1] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [2] Role of RUNX2 transcription factor in epithelial mesenchymal transition in non-small cell lung cancer lung cancer: Epigenetic control of the RUNX2 P1 promoter.Tumour Biol. 2019 May;41(5):1010428319851014. doi: 10.1177/1010428319851014.
• [3] Long non-coding RNA LUCAT1 is associated with poor prognosis in human non-small lung cancer and regulates cell proliferation via epigenetically repressing p21 and p57 expression.Oncotarget. 2017 Apr 25;8(17):28297-28311. doi: 10.18632/oncotarget.16044.
• [4] Microglial motility in Alzheimer's disease and after A42 immunotherapy: a human post-mortem study.Acta Neuropathol Commun. 2019 Nov 8;7(1):174. doi: 10.1186/s40478-019-0828-x.
• [5] Prognostic significance of O6-methylguanine DNA methyltransferase and p57 methylation in patients with diffuse large B-cell lymphomas.APMIS. 2009 Feb;117(2):87-94. doi: 10.1111/j.1600-0463.2008.00017.x.
• [6] Targeted demethylation at the CDKN1C/p57 locus induces human cell replication.J Clin Invest. 2019 Jan 2;129(1):209-214. doi: 10.1172/JCI99170. Epub 2018 Nov 26.
• [7] CDK inhibitor p57 (Kip2) is downregulated by Akt during HER2-mediated tumorigenicity.Cell Cycle. 2013 Mar 15;12(6):935-43. doi: 10.4161/cc.23883. Epub 2013 Feb 19.
• [8] Butyrate inhibits pro-proliferative miR-92a by diminishing c-Myc-induced miR-17-92a cluster transcription in human colon cancer cells.Mol Cancer. 2015 Oct 13;14:180. doi: 10.1186/s12943-015-0450-x.
• [9] Does Ki-67 Have a Role in the Diagnosis of Placental Molar Disease?.Int J Gynecol Pathol. 2020 Jan;39(1):1-7. doi: 10.1097/PGP.0000000000000558.
• [10] Stem cell associated genes working with one miRNA cluster have different clinic pathologic values in gastric cancer.Pathol Oncol Res. 2011 Dec;17(4):939-46. doi: 10.1007/s12253-011-9407-6. Epub 2011 May 10.
• [11] P57-mediated autophagy promotes the efficacy of EGFR inhibitors in hepatocellular carcinoma.Liver Int. 2019 Jan;39(1):147-157. doi: 10.1111/liv.13957. Epub 2018 Oct 8.
• [12] p57 in Hydatidiform Moles: Evaluation of Antibodies and Expression in Various Cell Types.Appl Immunohistochem Mol Morphol. 2020 Oct;28(9):694-701. doi: 10.1097/PAI.0000000000000807.
• [13] Histologic and Molecular Profile of Pediatric Insulinomas: Evidence of a Paternal Parent-of-Origin Effect.J Clin Endocrinol Metab. 2016 Mar;101(3):914-22. doi: 10.1210/jc.2015-2914. Epub 2016 Jan 12.
• [14] Genetics of SLE: evidence from mouse models.Nat Rev Rheumatol. 2010 Jun;6(6):348-57. doi: 10.1038/nrrheum.2010.63. Epub 2010 May 4.
• [15] Severe combined immunodeficiency (SCID) and attention deficit hyperactivity disorder (ADHD) associated with a Coronin-1A mutation and a chromosome 16p11.2 deletion.Clin Immunol. 2009 Apr;131(1):24-30. doi: 10.1016/j.clim.2008.11.002. Epub 2008 Dec 20.
• [16] Recurrent viral infections associated with a homozygous CORO1A mutation that disrupts oligomerization and cytoskeletal association.J Allergy Clin Immunol. 2016 Mar;137(3):879-88.e2. doi: 10.1016/j.jaci.2015.08.020. Epub 2015 Oct 21.
• [17] Expression of p57/Kip2 protein in normal and neoplastic thyroid tissues.Int J Mol Med. 2002 Apr;9(4):373-6.
• [18] Long Non-Coding RNA SH3PXD2A-AS1 Promotes Cell Progression Partly Through Epigenetic Silencing P57 and KLF2 in Colorectal Cancer.Cell Physiol Biochem. 2018;46(6):2197-2214. doi: 10.1159/000489589. Epub 2018 May 3.
• [19] The Gene Curation Coalition: A global effort to harmonize gene-disease evidence resources. Genet Med. 2022 Aug;24(8):1732-1742. doi: 10.1016/j.gim.2022.04.017. Epub 2022 May 4.
• [20] The practice of diagnosing and reporting transfusion-associated circulatory overload: a national survey among physicians and haemovigilance officers.Transfus Med. 2018 Oct;28(5):363-370. doi: 10.1111/tme.12480. Epub 2017 Oct 23.
• [21] Compound heterozygous CORO1A mutations in siblings with a mucocutaneous-immunodeficiency syndrome of epidermodysplasia verruciformis-HPV, molluscum contagiosum and granulomatous tuberculoid leprosy.J Clin Immunol. 2014 Oct;34(7):871-90. doi: 10.1007/s10875-014-0074-8. Epub 2014 Jul 30.
• [22] Expression, correlation and prognostic significance of CD133, P57 and HSF1 in meningioma.Eur Rev Med Pharmacol Sci. 2017 Oct;21(20):4600-4605.
• [23] Vitamin D3 analogue EB1089 inhibits the proliferation of human laryngeal squamous carcinoma cells via p57.Mol Cancer Ther. 2008 May;7(5):1268-74. doi: 10.1158/1535-7163.MCT-07-2222.
• [24] Effusion and solid lymphomas have distinctive gene and protein expression profiles in an animal model of primary effusion lymphoma.J Pathol. 2006 Aug;209(4):464-73. doi: 10.1002/path.2012.
• [25] Epigenetic inactivation of the CIP/KIP cell-cycle control pathway in acute leukemias.Am J Hematol. 2005 Dec;80(4):282-7. doi: 10.1002/ajh.20503.
• [26] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [27] Long noncoding RNA HOXD-AS1 aggravates osteosarcoma carcinogenesis through epigenetically inhibiting p57 via EZH2.Biomed Pharmacother. 2018 Oct;106:890-895. doi: 10.1016/j.biopha.2018.06.173. Epub 2018 Jul 12.
• [28] Methylation silencing of angiopoietin-like 4 in rat and human mammary carcinomas.Cancer Sci. 2011 Jul;102(7):1337-43. doi: 10.1111/j.1349-7006.2011.01955.x. Epub 2011 May 12.
• [29] Cyclin D1 and p57 expression in relation to clinicopathological characteristics and overall survival in patients with renal cell carcinoma.J BUON. 2019 Jan-Feb;24(1):301-309.
• [30] EZH2 regulates expression of p57 and contributes to progression of ovarian cancer in vitro and in vivo.Cancer Sci. 2011 Mar;102(3):530-9. doi: 10.1111/j.1349-7006.2010.01836.x. Epub 2011 Jan 18.
• [31] Emergent Role of Coronin-1a in Neuronal Signaling.Vitam Horm. 2017;104:113-131. doi: 10.1016/bs.vh.2016.10.002. Epub 2016 Nov 29.
• [32] Genomic organization of the human p57KIP2 gene and its analysis in the G401 Wilms' tumor assay.Cancer Res. 1996 Mar 15;56(6):1214-8.
• [33] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [34] Retinoic acid receptor alpha amplifications and retinoic acid sensitivity in breast cancers. Clin Breast Cancer. 2013 Oct;13(5):401-8.
• [35] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [36] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [37] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [38] Proteomic and functional analyses reveal a dual molecular mechanism underlying arsenic-induced apoptosis in human multiple myeloma cells. J Proteome Res. 2009 Jun;8(6):3006-19.
• [39] Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
• [40] The contribution of methotrexate exposure and host factors on transcriptional variance in human liver. Toxicol Sci. 2007 Jun;97(2):582-94.
• [41] Downregulation of TACO gene transcription restricts mycobacterial entry/survival within human macrophages. FEMS Microbiol Lett. 2005 Sep 1;250(1):137-44. doi: 10.1016/j.femsle.2005.06.056.
• [42] Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
• [43] Synergistic effect of JQ1 and rapamycin for treatment of human osteosarcoma. Int J Cancer. 2015 May 1;136(9):2055-64.
• [44] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [45] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [46] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [47] ST1926, a novel and orally active retinoid-related molecule inducing apoptosis in myeloid leukemia cells: modulation of intracellular calcium homeostasis. Blood. 2004 Jan 1;103(1):194-207.
• [48] MS4A3-HSP27 target pathway reveals potential for haematopoietic disorder treatment in alimentary toxic aleukia. Cell Biol Toxicol. 2023 Feb;39(1):201-216. doi: 10.1007/s10565-021-09639-4. Epub 2021 Sep 28.