Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXIN6V5)

DOT Name Angiopoietin-related protein 1 (ANGPTL1)
Synonyms Angiopoietin-3; ANG-3; Angiopoietin-like protein 1
Gene Name ANGPTL1
Related Disease
Cerebral infarction ( )
Glioma ( )
Malignant glioma ( )
Acute leukaemia ( )
Advanced cancer ( )
Breast cancer ( )
Breast carcinoma ( )
Carcinoma ( )
Choriocarcinoma ( )
Corneal neovascularization ( )
Fibrosarcoma ( )
Immunodeficiency ( )
Lung cancer ( )
Lung carcinoma ( )
Lung neoplasm ( )
Melanoma ( )
Metastatic malignant neoplasm ( )
Neoplasm ( )
Plasma cell myeloma ( )
Polycystic ovarian syndrome ( )
Spinocerebellar ataxia type 5 ( )
Cardiovascular disease ( )
Colorectal carcinoma ( )
Hepatocellular carcinoma ( )
High blood pressure ( )
Stroke ( )
UniProt ID
ANGL1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00147
Sequence
MKTFTWTLGVLFFLLVDTGHCRGGQFKIKKINQRRYPRATDGKEEAKKCAYTFLVPEQRI
TGPICVNTKGQDASTIKDMITRMDLENLKDVLSRQKREIDVLQLVVDVDGNIVNEVKLLR
KESRNMNSRVTQLYMQLLHEIIRKRDNSLELSQLENKILNVTTEMLKMATRYRELEVKYA
SLTDLVNNQSVMITLLEEQCLRIFSRQDTHVSPPLVQVVPQHIPNSQQYTPGLLGGNEIQ
RDPGYPRDLMPPPDLATSPTKSPFKIPPVTFINEGPFKDCQQAKEAGHSVSGIYMIKPEN
SNGPMQLWCENSLDPGGWTVIQKRTDGSVNFFRNWENYKKGFGNIDGEYWLGLENIYMLS
NQDNYKLLIELEDWSDKKVYAEYSSFRLEPESEFYRLRLGTYQGNAGDSMMWHNGKQFTT
LDRDKDMYAGNCAHFHKGGWWYNACAHSNLNGVWYRGGHYRSKHQDGIFWAEYRGGSYSL
RAVQMMIKPID
Tissue Specificity Highly expressed in adrenal gland, placenta, thyroid gland, heart, skeletal muscle and small intestine. Weakly expressed in testis, ovary, colon, pancreas, kidney and stomach.

Molecular Interaction Atlas (MIA) of This DOT

26 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Cerebral infarction DISR1WNP Definitive Biomarker [1]
Glioma DIS5RPEH Definitive Biomarker [2]
Malignant glioma DISFXKOV Definitive Biomarker [2]
Acute leukaemia DISDQFDI Strong Genetic Variation [3]
Advanced cancer DISAT1Z9 Strong Biomarker [4]
Breast cancer DIS7DPX1 Strong Biomarker [5]
Breast carcinoma DIS2UE88 Strong Biomarker [5]
Carcinoma DISH9F1N Strong Altered Expression [6]
Choriocarcinoma DISDBVNL Strong Altered Expression [7]
Corneal neovascularization DISKOGZP Strong Biomarker [8]
Fibrosarcoma DISWX7MU Strong Altered Expression [9]
Immunodeficiency DIS093I0 Strong Biomarker [10]
Lung cancer DISCM4YA Strong Biomarker [11]
Lung carcinoma DISTR26C Strong Biomarker [11]
Lung neoplasm DISVARNB Strong Altered Expression [6]
Melanoma DIS1RRCY Strong Biomarker [12]
Metastatic malignant neoplasm DIS86UK6 Strong Biomarker [13]
Neoplasm DISZKGEW Strong Altered Expression [4]
Plasma cell myeloma DIS0DFZ0 Strong Biomarker [14]
Polycystic ovarian syndrome DISZ2BNG Strong Altered Expression [15]
Spinocerebellar ataxia type 5 DISPYXJ0 Strong Genetic Variation [16]
Cardiovascular disease DIS2IQDX moderate Biomarker [17]
Colorectal carcinoma DIS5PYL0 Limited Altered Expression [4]
Hepatocellular carcinoma DIS0J828 Limited Biomarker [18]
High blood pressure DISY2OHH Limited Biomarker [19]
Stroke DISX6UHX Limited Biomarker [20]
------------------------------------------------------------------------------------
⏷ Show the Full List of 26 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Angiopoietin-related protein 1 (ANGPTL1). [21]
------------------------------------------------------------------------------------
14 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Angiopoietin-related protein 1 (ANGPTL1). [22]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Angiopoietin-related protein 1 (ANGPTL1). [23]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Angiopoietin-related protein 1 (ANGPTL1). [24]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of Angiopoietin-related protein 1 (ANGPTL1). [25]
Triclosan DMZUR4N Approved Triclosan decreases the expression of Angiopoietin-related protein 1 (ANGPTL1). [26]
Dexamethasone DMMWZET Approved Dexamethasone increases the expression of Angiopoietin-related protein 1 (ANGPTL1). [27]
Permethrin DMZ0Q1G Approved Permethrin decreases the expression of Angiopoietin-related protein 1 (ANGPTL1). [28]
Rofecoxib DM3P5DA Approved Rofecoxib decreases the expression of Angiopoietin-related protein 1 (ANGPTL1). [29]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Angiopoietin-related protein 1 (ANGPTL1). [30]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Angiopoietin-related protein 1 (ANGPTL1). [31]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide decreases the expression of Angiopoietin-related protein 1 (ANGPTL1). [32]
Geldanamycin DMS7TC5 Discontinued in Phase 2 Geldanamycin decreases the expression of Angiopoietin-related protein 1 (ANGPTL1). [25]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Angiopoietin-related protein 1 (ANGPTL1). [25]
Milchsaure DM462BT Investigative Milchsaure increases the expression of Angiopoietin-related protein 1 (ANGPTL1). [33]
------------------------------------------------------------------------------------
⏷ Show the Full List of 14 Drug(s)

References

1 Angiopoietin-like protein 1 decreases blood brain barrier damage and edema following focal cerebral ischemia in mice.Neurochem Int. 2008 Feb;52(3):470-7. doi: 10.1016/j.neuint.2007.08.010. Epub 2007 Aug 22.
2 Construction of a ganciclovir-sensitive lentiviral vector to assess the influence of angiopoietin-3 and soluble Tie2 on glioma growth.J Neurooncol. 2010 Aug;99(1):1-11. doi: 10.1007/s11060-009-0095-y. Epub 2009 Dec 18.
3 Identification and characterization of the ARP1 gene, a target for the human acute leukemia ALL1 gene.Proc Natl Acad Sci U S A. 1998 Apr 14;95(8):4573-8. doi: 10.1073/pnas.95.8.4573.
4 Angiopoietin-like protein 1 inhibits epithelial to mesenchymal transition in colorectal cancer cells via suppress Slug expression.Cytotechnology. 2019 Feb;71(1):35-44. doi: 10.1007/s10616-018-0259-8. Epub 2019 Jan 4.
5 ANGPTL1 attenuates colorectal cancer metastasis by up-regulating microRNA-138.J Exp Clin Cancer Res. 2017 Jun 12;36(1):78. doi: 10.1186/s13046-017-0548-7.
6 Angioarrestin mRNA expression in early-stage lung cancers.Eur J Surg Oncol. 2003 Oct;29(8):649-53. doi: 10.1016/s0748-7983(03)00106-9.
7 The ARP-1 orphan receptor represses steroid-mediated stimulation of human placental lactogen gene expression.J Mol Endocrinol. 1996 Jun;16(3):221-7. doi: 10.1677/jme.0.0160221.
8 Biological characterization of angiopoietin-3 and angiopoietin-4.FASEB J. 2004 Aug;18(11):1200-8. doi: 10.1096/fj.03-1466com.
9 miR-409-3p inhibits HT1080 cell proliferation, vascularization and metastasis by targeting angiogenin.Cancer Lett. 2012 Oct 28;323(2):171-9. doi: 10.1016/j.canlet.2012.04.010. Epub 2012 Apr 21.
10 Rice-based oral antibody fragment prophylaxis and therapy against rotavirus infection.J Clin Invest. 2013 Sep;123(9):3829-38. doi: 10.1172/JCI70266. Epub 2013 Aug 8.
11 Angiopoietin-like protein 1 suppresses SLUG to inhibit cancer cell motility.J Clin Invest. 2013 Mar;123(3):1082-95. doi: 10.1172/JCI64044. Epub 2013 Feb 22.
12 Recombinant angioarrestin secreted from mouse melanoma cells inhibits growth of primary tumours.Acta Biochim Pol. 2005;52(4):875-9. Epub 2005 Jun 6.
13 Angiopoietin-3 inhibits pulmonary metastasis by inhibiting tumor angiogenesis.Cancer Res. 2004 Sep 1;64(17):6119-26. doi: 10.1158/0008-5472.CAN-04-1054.
14 DCZ0814 induces apoptosis and G0/G1 phase cell cycle arrest in myeloma by dual inhibition of mTORC1/2.Cancer Manag Res. 2019 May 27;11:4797-4808. doi: 10.2147/CMAR.S194202. eCollection 2019.
15 Aberrant expression of angiopoietin-like proteins 1 and 2 in cumulus cells is potentially associated with impaired oocyte developmental competence in polycystic ovary syndrome.Gynecol Endocrinol. 2016 Jul;32(7):557-61. doi: 10.3109/09513590.2016.1138463. Epub 2016 Feb 1.
16 Beta-III spectrin mutation L253P associated with spinocerebellar ataxia type 5 interferes with binding to Arp1 and protein trafficking from the Golgi.Hum Mol Genet. 2010 Sep 15;19(18):3634-41. doi: 10.1093/hmg/ddq279. Epub 2010 Jul 5.
17 Effects of angiotensin III on c-Jun N terminal kinase in Wistar and hypertensive rat vascular smooth muscle cells.Peptides. 2020 Jan;123:170204. doi: 10.1016/j.peptides.2019.170204. Epub 2019 Nov 15.
18 Long noncoding RNA GAS5 inhibits metastasis by targeting miR-182/ANGPTL1 in hepatocellular carcinoma.Am J Cancer Res. 2019 Jan 1;9(1):108-121. eCollection 2019.
19 Evolution of a New Class of Antihypertensive Drugs: Targeting the Brain Renin-Angiotensin System.Hypertension. 2020 Jan;75(1):6-15. doi: 10.1161/HYPERTENSIONAHA.119.12675. Epub 2019 Dec 2.
20 Revisiting the Brain Renin-Angiotensin System-Focus on Novel Therapies.Curr Hypertens Rep. 2019 Apr 4;21(4):28. doi: 10.1007/s11906-019-0937-8.
21 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
22 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
23 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
24 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
25 Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
26 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
27 Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
28 Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
29 Rofecoxib modulates multiple gene expression pathways in a clinical model of acute inflammatory pain. Pain. 2007 Mar;128(1-2):136-47.
30 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
31 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
32 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
33 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.