Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXKORJP)

• DOT Name: Interferon-induced protein 44-like (IFI44L)
• Gene Name: IFI44L
• Related Disease:
  Adult respiratory distress syndrome
  Autoimmune disease
  Bone osteosarcoma
  Influenza
  Major depressive disorder
  Measles
  Osteosarcoma
  Rheumatoid arthritis
  Advanced cancer
  Autoimmune polyendocrinopathy
  Bacterial infection
  Neoplasm
  Systemic lupus erythematosus
• UniProt ID: IF44L_HUMAN
• Sequence:
  MEVTTRLTWNDENHLRKLLGNVSLSLLYKSSVHGGSIEDMVERCSRQGCTITMAYIDYNM
  IVAFMLGNYINLHESSTEPNDSLWFSLQKKNDTTEIETLLLNTAPKIIDEQLVCRLSKTD
  IFIICRDNKIYLDKMITRNLKLRFYGHRQYLECEVFRVEGIKDNLDDIKRIIKAREHRNR
  LLADIRDYRPYADLVSEIRILLVGPVGSGKSSFFNSVKSIFHGHVTGQAVVGSDITSITE
  RYRIYSVKDGKNGKSLPFMLCDTMGLDGAEGAGLCMDDIPHILKGCMPDRYQFNSRKPIT
  PEHSTFITSPSLKDRIHCVAYVLDINSIDNLYSKMLAKVKQVHKEVLNCGIAYVALLTKV
  DDCSEVLQDNFLNMSRSMTSQSRVMNVHKMLGIPISNILMVGNYASDLELDPMKDILILS
  ALRQMLRAADDFLEDLPLEETGAIERALQPCI
• Function: Type I interferon-stimulated gene (ISG) that plays a critical role in antiviral and antibacterial activity. During bacterial infection, promotes macrophage differentiation and facilitates inflammatory cytokine secretion. Plays a role in the control of respiratory syncytial virus/RSV infection, reducing the ability of the virus to replicate. Exhibits a low antiviral activity against hepatitis C virus. Acts also as a feedback regulator of IFN responses by negatively regulating IKBKB and IKBKE kinase activities through interaction with FKBP5.

Molecular Interaction Atlas (MIA) of This DOT

13 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adult respiratory distress syndrome	DISIJV47	Strong	Biomarker	[1]
Autoimmune disease	DISORMTM	Strong	Posttranslational Modification	[2]
Bone osteosarcoma	DIST1004	Strong	Altered Expression	[3]
Influenza	DIS3PNU3	Strong	Biomarker	[4]
Major depressive disorder	DIS4CL3X	Strong	Biomarker	[5]
Measles	DISXSUID	Strong	Genetic Variation	[6]
Osteosarcoma	DISLQ7E2	Strong	Altered Expression	[3]
Rheumatoid arthritis	DISTSB4J	Strong	Genetic Variation	[2]
Advanced cancer	DISAT1Z9	Limited	Biomarker	[7]
Autoimmune polyendocrinopathy	DISOLDB2	Limited	Genetic Variation	[8]
Bacterial infection	DIS5QJ9S	Limited	Biomarker	[9]
Neoplasm	DISZKGEW	Limited	Biomarker	[7]
Systemic lupus erythematosus	DISI1SZ7	Limited	Posttranslational Modification	[10]

25 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Interferon-induced protein 44-like (IFI44L).	[11]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Interferon-induced protein 44-like (IFI44L).	[12]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Interferon-induced protein 44-like (IFI44L).	[13]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Interferon-induced protein 44-like (IFI44L).	[14]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Interferon-induced protein 44-like (IFI44L).	[15]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Interferon-induced protein 44-like (IFI44L).	[17]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Interferon-induced protein 44-like (IFI44L).	[18]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Interferon-induced protein 44-like (IFI44L).	[19]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Interferon-induced protein 44-like (IFI44L).	[20]
Hydroquinone	DM6AVR4	Approved	Hydroquinone decreases the expression of Interferon-induced protein 44-like (IFI44L).	[21]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of Interferon-induced protein 44-like (IFI44L).	[19]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of Interferon-induced protein 44-like (IFI44L).	[22]
Diclofenac	DMPIHLS	Approved	Diclofenac decreases the expression of Interferon-induced protein 44-like (IFI44L).	[19]
Nicotine	DMWX5CO	Approved	Nicotine increases the expression of Interferon-induced protein 44-like (IFI44L).	[23]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of Interferon-induced protein 44-like (IFI44L).	[19]
Malathion	DMXZ84M	Approved	Malathion increases the expression of Interferon-induced protein 44-like (IFI44L).	[24]
Prednisolone	DMQ8FR2	Approved	Prednisolone decreases the expression of Interferon-induced protein 44-like (IFI44L).	[19]
Methylprednisolone	DM4BDON	Approved	Methylprednisolone decreases the expression of Interferon-induced protein 44-like (IFI44L).	[19]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Interferon-induced protein 44-like (IFI44L).	[26]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Interferon-induced protein 44-like (IFI44L).	[27]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Interferon-induced protein 44-like (IFI44L).	[28]
Deguelin	DMXT7WG	Investigative	Deguelin increases the expression of Interferon-induced protein 44-like (IFI44L).	[29]
Paraquat	DMR8O3X	Investigative	Paraquat decreases the expression of Interferon-induced protein 44-like (IFI44L).	[30]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the expression of Interferon-induced protein 44-like (IFI44L).	[31]
cinnamaldehyde	DMZDUXG	Investigative	cinnamaldehyde decreases the expression of Interferon-induced protein 44-like (IFI44L).	[32]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Interferon-induced protein 44-like (IFI44L).	[16]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Interferon-induced protein 44-like (IFI44L).	[25]

References

• [1] Whole blood RNA sequencing reveals a unique transcriptomic profile in patients with ARDS following hematopoietic stem cell transplantation.Respir Res. 2019 Jan 21;20(1):15. doi: 10.1186/s12931-019-0981-6.
• [2] IFI44L promoter methylation as a blood biomarker for systemic lupus erythematosus.Ann Rheum Dis. 2016 Nov;75(11):1998-2006. doi: 10.1136/annrheumdis-2015-208410. Epub 2016 Jan 19.
• [3] miR-628-5p promotes growth and migration of osteosarcoma by targeting IFI44L.Biochem Cell Biol. 2020 Apr;98(2):99-105. doi: 10.1139/bcb-2019-0001. Epub 2019 Apr 24.
• [4] A host transcriptional signature for presymptomatic detection of infection in humans exposed to influenza H1N1 or H3N2.PLoS One. 2013;8(1):e52198. doi: 10.1371/journal.pone.0052198. Epub 2013 Jan 9.
• [5] Altered neuro-inflammatory gene expression in hippocampus in major depressive disorder.Prog Neuropsychopharmacol Biol Psychiatry. 2018 Mar 2;82:177-186. doi: 10.1016/j.pnpbp.2017.11.017. Epub 2017 Nov 22.
• [6] Current perspectives in assessing humoral immunity after measles vaccination.Expert Rev Vaccines. 2019 Jan;18(1):75-87. doi: 10.1080/14760584.2019.1559063. Epub 2018 Dec 26.
• [7] IFI44L is a novel tumor suppressor in human hepatocellular carcinoma affecting cancer stemness, metastasis, and drug resistance via regulating met/Src signaling pathway.BMC Cancer. 2018 May 30;18(1):609. doi: 10.1186/s12885-018-4529-9.
• [8] Genome-wide DNA methylation analysis in primary antiphospholipid syndrome neutrophils.Clin Immunol. 2018 Nov;196:110-116. doi: 10.1016/j.clim.2018.11.011. Epub 2018 Nov 22.
• [9] A qPCR expression assay of IFI44L gene differentiates viral from bacterial infections in febrile children.Sci Rep. 2019 Aug 13;9(1):11780. doi: 10.1038/s41598-019-48162-9.
• [10] Interferon-induced protein 44-like gene promoter is differentially methylated in peripheral blood mononuclear cells of systemic lupus erythematosus patients.J Res Med Sci. 2019 Nov 27;24:99. doi: 10.4103/jrms.JRMS_83_19. eCollection 2019.
• [11] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [12] Cyclosporine A--induced oxidative stress in human renal mesangial cells: a role for ERK 1/2 MAPK signaling. Toxicol Sci. 2012 Mar;126(1):101-13.
• [13] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [14] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [15] Effects of progesterone treatment on expression of genes involved in uterine quiescence. Reprod Sci. 2011 Aug;18(8):781-97.
• [16] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [17] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [18] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [19] Antirheumatic drug response signatures in human chondrocytes: potential molecular targets to stimulate cartilage regeneration. Arthritis Res Ther. 2009;11(1):R15.
• [20] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [21] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [22] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [23] Characterizing the genetic basis for nicotine induced cancer development: a transcriptome sequencing study. PLoS One. 2013 Jun 18;8(6):e67252.
• [24] Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
• [25] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [26] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [27] Comparison of transcriptome expression alterations by chronic exposure to low-dose bisphenol A in different subtypes of breast cancer cells. Toxicol Appl Pharmacol. 2019 Dec 15;385:114814. doi: 10.1016/j.taap.2019.114814. Epub 2019 Nov 9.
• [28] Regulation of chromatin assembly and cell transformation by formaldehyde exposure in human cells. Environ Health Perspect. 2017 Sep 21;125(9):097019.
• [29] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [30] An in vitro strategy using multiple human induced pluripotent stem cell-derived models to assess the toxicity of chemicals: A case study on paraquat. Toxicol In Vitro. 2022 Jun;81:105333. doi: 10.1016/j.tiv.2022.105333. Epub 2022 Feb 16.
• [31] Effects of nickel treatment on H3K4 trimethylation and gene expression. PLoS One. 2011 Mar 24;6(3):e17728. doi: 10.1371/journal.pone.0017728.
• [32] Comparative DNA microarray analysis of human monocyte derived dendritic cells and MUTZ-3 cells exposed to the moderate skin sensitizer cinnamaldehyde. Toxicol Appl Pharmacol. 2009 Sep 15;239(3):273-83.