Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTY0ECQN)

• DOT Name: Transmembrane 4 L6 family member 1 (TM4SF1)
• Synonyms: Membrane component chromosome 3 surface marker 1; Tumor-associated antigen L6
• Gene Name: TM4SF1
• Related Disease:
  Invasive breast carcinoma
  Neoplasm
  Pancreatic cancer
  Advanced cancer
  B-cell neoplasm
  Bladder cancer
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Carcinoma of esophagus
  Colon cancer
  Colorectal carcinoma
  Epithelial ovarian cancer
  Esophageal cancer
  Esophageal squamous cell carcinoma
  Hepatocellular carcinoma
  Hyperlipidemia
  Lung cancer
  Lung carcinoma
  Neoplasm of esophagus
  Non-small-cell lung cancer
  Ovarian cancer
  Ovarian neoplasm
  Triple negative breast cancer
  Urinary bladder cancer
  Urinary bladder neoplasm
  Benign prostatic hyperplasia
  Carcinoma
  Matthew-Wood syndrome
  Pancreatic ductal carcinoma
  Prostate cancer
  Prostate carcinoma
• UniProt ID: T4S1_HUMAN
• Pfam ID: PF05805
• Sequence:
  MCYGKCARCIGHSLVGLALLCIAANILLYFPNGETKYASENHLSRFVWFFSGIVGGGLLM
  LLPAFVFIGLEQDDCCGCCGHENCGKRCAMLSSVLAALIGIAGSGYCVIVAALGLAEGPL
  CLDSLGQWNYTFASTEGQYLLDTSTWSECTEPKHIVEWNVSLFSILLALGGIEFILCLIQ
  VINGVLGGICGFCCSHQQQYDC
• Tissue Specificity: Highly expressed in lung, breast, colon and ovarian carcinomas. It is also present on some normal cells, endothelial cells in particular.

Molecular Interaction Atlas (MIA) of This DOT

32 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Invasive breast carcinoma	DISANYTW	Definitive	Altered Expression	[1]
Neoplasm	DISZKGEW	Definitive	Altered Expression	[2]
Pancreatic cancer	DISJC981	Definitive	Biomarker	[3]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[4]
B-cell neoplasm	DISVY326	Strong	Altered Expression	[5]
Bladder cancer	DISUHNM0	Strong	Biomarker	[6]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[7]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[7]
Breast neoplasm	DISNGJLM	Strong	Altered Expression	[7]
Carcinoma of esophagus	DISS6G4D	Strong	Biomarker	[8]
Colon cancer	DISVC52G	Strong	Biomarker	[9]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[10]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[2]
Esophageal cancer	DISGB2VN	Strong	Biomarker	[8]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Altered Expression	[8]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[11]
Hyperlipidemia	DIS61J3S	Strong	Biomarker	[12]
Lung cancer	DISCM4YA	Strong	Altered Expression	[13]
Lung carcinoma	DISTR26C	Strong	Altered Expression	[13]
Neoplasm of esophagus	DISOLKAQ	Strong	Biomarker	[8]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[13]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[2]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[2]
Triple negative breast cancer	DISAMG6N	Strong	Biomarker	[7]
Urinary bladder cancer	DISDV4T7	Strong	Biomarker	[6]
Urinary bladder neoplasm	DIS7HACE	Strong	Biomarker	[6]
Benign prostatic hyperplasia	DISI3CW2	moderate	Altered Expression	[14]
Carcinoma	DISH9F1N	moderate	Altered Expression	[15]
Matthew-Wood syndrome	DISA7HR7	moderate	Biomarker	[16]
Pancreatic ductal carcinoma	DIS26F9Q	moderate	Altered Expression	[16]
Prostate cancer	DISF190Y	moderate	Altered Expression	[14]
Prostate carcinoma	DISMJPLE	moderate	Altered Expression	[14]

29 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Transmembrane 4 L6 family member 1 (TM4SF1).	[17]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Transmembrane 4 L6 family member 1 (TM4SF1).	[18]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Transmembrane 4 L6 family member 1 (TM4SF1).	[19]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Transmembrane 4 L6 family member 1 (TM4SF1).	[20]
Ivermectin	DMDBX5F	Approved	Ivermectin increases the expression of Transmembrane 4 L6 family member 1 (TM4SF1).	[21]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Transmembrane 4 L6 family member 1 (TM4SF1).	[22]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Transmembrane 4 L6 family member 1 (TM4SF1).	[23]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Transmembrane 4 L6 family member 1 (TM4SF1).	[24]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Transmembrane 4 L6 family member 1 (TM4SF1).	[25]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Transmembrane 4 L6 family member 1 (TM4SF1).	[26]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Transmembrane 4 L6 family member 1 (TM4SF1).	[28]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of Transmembrane 4 L6 family member 1 (TM4SF1).	[29]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the expression of Transmembrane 4 L6 family member 1 (TM4SF1).	[30]
Cyclophosphamide	DM4O2Z7	Approved	Cyclophosphamide increases the expression of Transmembrane 4 L6 family member 1 (TM4SF1).	[31]
Bexarotene	DMOBIKY	Approved	Bexarotene increases the expression of Transmembrane 4 L6 family member 1 (TM4SF1).	[32]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Transmembrane 4 L6 family member 1 (TM4SF1).	[33]
Isoflavone	DM7U58J	Phase 4	Isoflavone decreases the expression of Transmembrane 4 L6 family member 1 (TM4SF1).	[34]
Seocalcitol	DMKL9QO	Phase 3	Seocalcitol decreases the expression of Transmembrane 4 L6 family member 1 (TM4SF1).	[35]
Coprexa	DMA0WEK	Phase 3	Coprexa decreases the expression of Transmembrane 4 L6 family member 1 (TM4SF1).	[36]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Transmembrane 4 L6 family member 1 (TM4SF1).	[37]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Transmembrane 4 L6 family member 1 (TM4SF1).	[38]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Transmembrane 4 L6 family member 1 (TM4SF1).	[39]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Transmembrane 4 L6 family member 1 (TM4SF1).	[40]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Transmembrane 4 L6 family member 1 (TM4SF1).	[41]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Transmembrane 4 L6 family member 1 (TM4SF1).	[42]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Transmembrane 4 L6 family member 1 (TM4SF1).	[43]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate decreases the expression of Transmembrane 4 L6 family member 1 (TM4SF1).	[44]
Lithium chloride	DMHYLQ2	Investigative	Lithium chloride increases the expression of Transmembrane 4 L6 family member 1 (TM4SF1).	[45]
ORG2058	DMH1M6N	Investigative	ORG2058 increases the expression of Transmembrane 4 L6 family member 1 (TM4SF1).	[46]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the methylation of Transmembrane 4 L6 family member 1 (TM4SF1).	[27]

References

• [1] Upregulation of transmembrane 4 L6 family member 1 predicts poor prognosis in invasive breast cancer: A STROBE-compliant article.Medicine (Baltimore). 2017 Dec;96(52):e9476. doi: 10.1097/MD.0000000000009476.
• [2] TM4SF1 is a potential target for anti-invasion and metastasis in ovarian cancer.BMC Cancer. 2019 Mar 15;19(1):237. doi: 10.1186/s12885-019-5417-7.
• [3] TM4SF1 Promotes Metastasis of Pancreatic Cancer via Regulating the Expression of DDR1.Sci Rep. 2017 Apr 3;7:45895. doi: 10.1038/srep45895.
• [4] Endoplasmic reticulum-targeting sequence enhanced the cellular immunity of a tumor-associated antigen L6-based DNA vaccine.Am J Cancer Res. 2019 Sep 1;9(9):2028-2036. eCollection 2019.
• [5] TM4SF1 inhibits apoptosis and promotes proliferation, migration and invasion in human gastric cancer cells.Oncol Lett. 2018 Nov;16(5):6081-6088. doi: 10.3892/ol.2018.9411. Epub 2018 Sep 6.
• [6] TM4SF1 regulates apoptosis, cell cycle and ROS metabolism via the PPAR-SIRT1 feedback loop in human bladder cancer cells.Cancer Lett. 2018 Feb 1;414:278-293. doi: 10.1016/j.canlet.2017.11.015. Epub 2017 Nov 24.
• [7] MicroRNA-206 inhibits metastasis of triple-negative breast cancer by targeting transmembrane 4 L6 family member 1.Cancer Manag Res. 2019 Jul 22;11:6755-6764. doi: 10.2147/CMAR.S199027. eCollection 2019.
• [8] TM4SF1 promotes the self-renewal of esophageal cancer stem-like cells and is regulated by miR-141.Oncotarget. 2017 Mar 21;8(12):19274-19284. doi: 10.18632/oncotarget.13866.
• [9] MicroRNA-9 suppresses cell migration and invasion through downregulation of TM4SF1 in colorectal cancer.Int J Oncol. 2016 May;48(5):2135-43. doi: 10.3892/ijo.2016.3430. Epub 2016 Mar 9.
• [10] MiRNA-206 suppresses PGE2-induced colorectal cancer cell proliferation, migration, and invasion by targetting TM4SF1.Biosci Rep. 2018 Sep 19;38(5):BSR20180664. doi: 10.1042/BSR20180664. Print 2018 Oct 31.
• [11] microRNA-520f inhibits hepatocellular carcinoma cell proliferation and invasion by targeting TM4SF1.Gene. 2018 May 30;657:30-38. doi: 10.1016/j.gene.2018.03.003. Epub 2018 Mar 2.
• [12] Weighted Gene Co-Expression Network Analysis Identifies Specific Modules and Hub Genes Related to Hyperlipidemia.Cell Physiol Biochem. 2018;48(3):1151-1163. doi: 10.1159/000491982. Epub 2018 Jul 25.
• [13] Transmembrane-4 L-six family member-1 (TM4SF1) promotes non-small cell lung cancer proliferation, invasion and chemo-resistance through regulating the DDR1/Akt/ERK-mTOR axis.Respir Res. 2019 May 29;20(1):106. doi: 10.1186/s12931-019-1071-5.
• [14] TM4SF1, a novel primary androgen receptor target gene over-expressed in human prostate cancer and involved in cell migration.Prostate. 2011 Aug 1;71(11):1239-50. doi: 10.1002/pros.21340. Epub 2011 Jan 12.
• [15] Clinical significance of TM4SF1 as a tumor suppressor gene in gastric cancer.Cancer Med. 2018 Jun;7(6):2592-2600. doi: 10.1002/cam4.1494. Epub 2018 Apr 17.
• [16] TM4SF1 Promotes Gemcitabine Resistance of Pancreatic Cancer In Vitro and In Vivo.PLoS One. 2015 Dec 28;10(12):e0144969. doi: 10.1371/journal.pone.0144969. eCollection 2015.
• [17] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [18] Inter-laboratory comparison of human renal proximal tubule (HK-2) transcriptome alterations due to Cyclosporine A exposure and medium exhaustion. Toxicol In Vitro. 2009 Apr;23(3):486-99.
• [19] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [20] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [21] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [22] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [23] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [24] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [25] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [26] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [27] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [28] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [29] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [30] CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
• [31] Comparative gene expression analysis of a chronic myelogenous leukemia cell line resistant to cyclophosphamide using oligonucleotide arrays and response to tyrosine kinase inhibitors. Leuk Res. 2007 Nov;31(11):1511-20.
• [32] Identification of biomarkers modulated by the rexinoid LGD1069 (bexarotene) in human breast cells using oligonucleotide arrays. Cancer Res. 2006 Dec 15;66(24):12009-18.
• [33] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [34] Soy isoflavones exert differential effects on androgen responsive genes in LNCaP human prostate cancer cells. J Nutr. 2007 Apr;137(4):964-72.
• [35] Expression profiling in squamous carcinoma cells reveals pleiotropic effects of vitamin D3 analog EB1089 signaling on cell proliferation, differentiation, and immune system regulation. Mol Endocrinol. 2002 Jun;16(6):1243-56.
• [36] Copper deprivation enhances the chemosensitivity of pancreatic cancer to rapamycin by mTORC1/2 inhibition. Chem Biol Interact. 2023 Sep 1;382:110546. doi: 10.1016/j.cbi.2023.110546. Epub 2023 Jun 7.
• [37] Gene expression changes in human prostate carcinoma cells exposed to genotoxic and nongenotoxic aryl hydrocarbon receptor ligands. Toxicol Lett. 2011 Oct 10;206(2):178-88.
• [38] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [39] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [40] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [41] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [42] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [43] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [44] Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
• [45] Early gene response in lithium chloride induced apoptosis. Apoptosis. 2005 Jan;10(1):75-90. doi: 10.1007/s10495-005-6063-x.
• [46] The antiproliferative effects of progestins in T47D breast cancer cells are tempered by progestin induction of the ETS transcription factor Elf5. Mol Endocrinol. 2010 Jul;24(7):1380-92. doi: 10.1210/me.2009-0516. Epub 2010 Jun 2.