Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZ7SZ39)

• DOT Name: Elongation factor 2 (EEF2)
• Synonyms: EF-2; EC 3.6.5.-
• Gene Name: EEF2
• Related Disease:
  Gastric cancer
  Intervertebral disc degeneration
  Leishmaniasis
  Stomach cancer
  Type-1 diabetes
  Adenocarcinoma
  Advanced cancer
  Alzheimer disease
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Chikungunya virus infection
  Clear cell renal carcinoma
  Depression
  Diphtheria
  Epilepsy
  Hepatocellular carcinoma
  Lung cancer
  Lung carcinoma
  Lung neoplasm
  Lung squamous cell carcinoma
  Neoplasm
  Papillary renal cell carcinoma
  Prostate cancer
  Prostate carcinoma
  Renal cell carcinoma
  Spinocerebellar ataxia type 26
  B-cell neoplasm
  Coronary atherosclerosis
  Glioblastoma multiforme
  Myocardial ischemia
  Myotonic dystrophy type 2
  Non-hodgkin lymphoma
  Colorectal carcinoma
  Neuroblastoma
  Osteoarthritis
  Parkinson disease
• UniProt ID: EF2_HUMAN
• PDB ID: 4V6X; 6D9J; 6Z6M; 6Z6N
• EC Number: 3.6.5.-
• Pfam ID: PF00679 ; PF14492 ; PF03764 ; PF00009 ; PF03144
• Sequence:
  MVNFTVDQIRAIMDKKANIRNMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTR
  KDEQERCITIKSTAISLFYELSENDLNFIKQSKDGAGFLINLIDSPGHVDFSSEVTAALR
  VTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQR
  IVENVNVIISTYGEGESGPMGNIMIDPVLGTVGFGSGLHGWAFTLKQFAEMYVAKFAAKG
  EGQLGPAERAKKVEDMMKKLWGDRYFDPANGKFSKSATSPEGKKLPRTFCQLILDPIFKV
  FDAIMNFKKEETAKLIEKLDIKLDSEDKDKEGKPLLKAVMRRWLPAGDALLQMITIHLPS
  PVTAQKYRCELLYEGPPDDEAAMGIKSCDPKGPLMMYISKMVPTSDKGRFYAFGRVFSGL
  VSTGLKVRIMGPNYTPGKKEDLYLKPIQRTILMMGRYVEPIEDVPCGNIVGLVGVDQFLV
  KTGTITTFEHAHNMRVMKFSVSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEE
  SGEHIIAGAGELHLEICLKDLEEDHACIPIKKSDPVVSYRETVSEESNVLCLSKSPNKHN
  RLYMKARPFPDGLAEDIDKGEVSARQELKQRARYLAEKYEWDVAEARKIWCFGPDGTGPN
  ILTDITKGVQYLNEIKDSVVAGFQWATKEGALCEENMRGVRFDVHDVTLHADAIHRGGGQ
  IIPTARRCLYASVLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQVAGTP
  MFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPFDNSSRPSQVVAETRK
  RKGLKEGIPALDNFLDKL
• Function: Catalyzes the GTP-dependent ribosomal translocation step during translation elongation. During this step, the ribosome changes from the pre-translocational (PRE) to the post-translocational (POST) state as the newly formed A-site-bound peptidyl-tRNA and P-site-bound deacylated tRNA move to the P and E sites, respectively. Catalyzes the coordinated movement of the two tRNA molecules, the mRNA and conformational changes in the ribosome.
• KEGG Pathway:
  AMPK sig.ling pathway (hsa04152)
  Oxytocin sig.ling pathway (hsa04921)
• Reactome Pathway:
  Uptake and function of diphtheria toxin (R-HSA-5336415)
  Synthesis of diphthamide-EEF2 (R-HSA-5358493)
  Neutrophil degranulation (R-HSA-6798695)
  Protein methylation (R-HSA-8876725)
  Peptide chain elongation (R-HSA-156902)

Molecular Interaction Atlas (MIA) of This DOT

37 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Gastric cancer	DISXGOUK	Definitive	Biomarker	[1]
Intervertebral disc degeneration	DISG3AIM	Definitive	Biomarker	[2]
Leishmaniasis	DISABTW7	Definitive	Biomarker	[3]
Stomach cancer	DISKIJSX	Definitive	Biomarker	[1]
Type-1 diabetes	DIS7HLUB	Definitive	Biomarker	[2]
Adenocarcinoma	DIS3IHTY	Strong	Biomarker	[4]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[5]
Alzheimer disease	DISF8S70	Strong	Biomarker	[6]
Breast cancer	DIS7DPX1	Strong	Biomarker	[7]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[7]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[7]
Chikungunya virus infection	DISDXEHY	Strong	Biomarker	[8]
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[9]
Depression	DIS3XJ69	Strong	Altered Expression	[10]
Diphtheria	DISZWM55	Strong	Biomarker	[11]
Epilepsy	DISBB28L	Strong	Biomarker	[12]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[13]
Lung cancer	DISCM4YA	Strong	Biomarker	[14]
Lung carcinoma	DISTR26C	Strong	Biomarker	[14]
Lung neoplasm	DISVARNB	Strong	Biomarker	[4]
Lung squamous cell carcinoma	DISXPIBD	Strong	Biomarker	[15]
Neoplasm	DISZKGEW	Strong	Biomarker	[13]
Papillary renal cell carcinoma	DIS25HBV	Strong	Biomarker	[9]
Prostate cancer	DISF190Y	Strong	Biomarker	[16]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[16]
Renal cell carcinoma	DISQZ2X8	Strong	Biomarker	[9]
Spinocerebellar ataxia type 26	DISBK94W	Strong	Autosomal dominant	[17]
B-cell neoplasm	DISVY326	moderate	Biomarker	[18]
Coronary atherosclerosis	DISKNDYU	moderate	Biomarker	[19]
Glioblastoma multiforme	DISK8246	moderate	Altered Expression	[20]
Myocardial ischemia	DISFTVXF	moderate	Biomarker	[19]
Myotonic dystrophy type 2	DIS5ZWF1	moderate	Biomarker	[21]
Non-hodgkin lymphoma	DISS2Y8A	moderate	Altered Expression	[5]
Colorectal carcinoma	DIS5PYL0	Limited	Genetic Variation	[22]
Neuroblastoma	DISVZBI4	Limited	Altered Expression	[23]
Osteoarthritis	DIS05URM	Limited	Biomarker	[24]
Parkinson disease	DISQVHKL	Limited	Altered Expression	[25]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Elongation factor 2 (EEF2) decreases the response to substance of Cisplatin.	[4]

8 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Elongation factor 2 (EEF2).	[26]
Arsenic	DMTL2Y1	Approved	Arsenic increases the ubiquitination of Elongation factor 2 (EEF2).	[30]
TAK-243	DM4GKV2	Phase 1	TAK-243 decreases the sumoylation of Elongation factor 2 (EEF2).	[41]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the phosphorylation of Elongation factor 2 (EEF2).	[43]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Elongation factor 2 (EEF2).	[44]
Coumarin	DM0N8ZM	Investigative	Coumarin affects the phosphorylation of Elongation factor 2 (EEF2).	[43]
Rapamycin Immunosuppressant Drug	DM678IB	Investigative	Rapamycin Immunosuppressant Drug increases the phosphorylation of Elongation factor 2 (EEF2).	[50]
torin 1	DMZD0NA	Investigative	torin 1 increases the phosphorylation of Elongation factor 2 (EEF2).	[50]

20 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Elongation factor 2 (EEF2).	[27]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Elongation factor 2 (EEF2).	[28]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Elongation factor 2 (EEF2).	[29]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Elongation factor 2 (EEF2).	[31]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Elongation factor 2 (EEF2).	[32]
Paclitaxel	DMLB81S	Approved	Paclitaxel decreases the expression of Elongation factor 2 (EEF2).	[33]
Nicotine	DMWX5CO	Approved	Nicotine increases the expression of Elongation factor 2 (EEF2).	[4]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Elongation factor 2 (EEF2).	[35]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Elongation factor 2 (EEF2).	[36]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Elongation factor 2 (EEF2).	[37]
Tanespimycin	DMNLQHK	Phase 2	Tanespimycin increases the expression of Elongation factor 2 (EEF2).	[38]
NVP-AUY922	DMTYXQF	Phase 2	NVP-AUY922 increases the expression of Elongation factor 2 (EEF2).	[38]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Elongation factor 2 (EEF2).	[39]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Elongation factor 2 (EEF2).	[40]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Elongation factor 2 (EEF2).	[42]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Elongation factor 2 (EEF2).	[45]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A increases the expression of Elongation factor 2 (EEF2).	[46]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate increases the expression of Elongation factor 2 (EEF2).	[47]
[3H]methyltrienolone	DMTSGOW	Investigative	[3H]methyltrienolone increases the expression of Elongation factor 2 (EEF2).	[48]
AHPN	DM8G6O4	Investigative	AHPN decreases the expression of Elongation factor 2 (EEF2).	[49]

References

• [1] miR-183-5p acts as a potential prognostic biomarker in gastric cancer and regulates cell functions by modulating EEF2.Pathol Res Pract. 2019 Nov;215(11):152636. doi: 10.1016/j.prp.2019.152636. Epub 2019 Sep 16.
• [2] MicroRNA-143-5p targeting eEF2 gene mediates intervertebral disc degeneration through the AMPK signaling pathway.Arthritis Res Ther. 2019 Apr 15;21(1):97. doi: 10.1186/s13075-019-1863-5.
• [3] Induction of protective cellular immune responses against experimental visceral leishmaniasis mediated by dendritic cells pulsed with the N-terminal domain of Leishmania infantum elongation factor-2 and CpG oligodeoxynucleotides.Mol Immunol. 2018 Nov;103:7-20. doi: 10.1016/j.molimm.2018.08.004. Epub 2018 Aug 30.
• [4] Sumoylation of eukaryotic elongation factor 2 is vital for protein stability and anti-apoptotic activity in lung adenocarcinoma cells. Cancer Sci. 2011 Aug;102(8):1582-9. doi: 10.1111/j.1349-7006.2011.01975.x. Epub 2011 Jun 23.
• [5] The translation elongation factor eEF2 is a novel tumorassociated antigen overexpressed in various types of cancers.Int J Oncol. 2014 May;44(5):1461-9. doi: 10.3892/ijo.2014.2318. Epub 2014 Mar 4.
• [6] Electroacupuncture Improves Synaptic Function in SAMP8 Mice Probably via Inhibition of the AMPK/eEF2K/eEF2 Signaling Pathway.Evid Based Complement Alternat Med. 2019 Sep 18;2019:8260815. doi: 10.1155/2019/8260815. eCollection 2019.
• [7] Glycolytic cancer associated fibroblasts promote breast cancer tumor growth, without a measurable increase in angiogenesis: evidence for stromal-epithelial metabolic coupling.Cell Cycle. 2010 Jun 15;9(12):2412-22. doi: 10.4161/cc.9.12.11989. Epub 2010 Jun 15.
• [8] Global protein profiling studies of chikungunya virus infection identify different proteins but common biological processes.Rev Med Virol. 2015 Jan;25(1):3-18. doi: 10.1002/rmv.1802. Epub 2014 Jul 27.
• [9] Differential protein profiling in renal-cell carcinoma.Mol Carcinog. 2004 May;40(1):47-61. doi: 10.1002/mc.20015.
• [10] Magnesium and ketamine in the treatment of depression.Psychiatr Danub. 2019 Sep;31(Suppl 3):549-553.
• [11] The hidden nature of protein translational control by diphthamide: the secrets under the leather.J Biochem. 2019 Jan 1;165(1):1-8. doi: 10.1093/jb/mvy071.
• [12] eEF2K/eEF2 Pathway Controls the Excitation/Inhibition Balance and Susceptibility to Epileptic Seizures.Cereb Cortex. 2017 Mar 1;27(3):2226-2248. doi: 10.1093/cercor/bhw075.
• [13] Eukaryotic elongation factor 2 is a prognostic marker and its kinase a potential therapeutic target in HCC.Oncotarget. 2017 Feb 14;8(7):11950-11962. doi: 10.18632/oncotarget.14447.
• [14] The expression profile and prognostic significance of eukaryotic translation elongation factors in different cancers.PLoS One. 2018 Jan 17;13(1):e0191377. doi: 10.1371/journal.pone.0191377. eCollection 2018.
• [15] Elevated eukaryotic elongation factor 2 expression is involved in proliferation and invasion of lung squamous cell carcinoma.Oncotarget. 2016 Sep 6;7(36):58470-58482. doi: 10.18632/oncotarget.11298.
• [16] Eukaryotic Elongation Factor 2 (eEF2) is a Potential Biomarker of Prostate Cancer.Pathol Oncol Res. 2018 Oct;24(4):885-890. doi: 10.1007/s12253-017-0302-7. Epub 2017 Sep 14.
• [17] Spinocerebellar ataxia type 26 maps to chromosome 19p13.3 adjacent to SCA6. Ann Neurol. 2005 Mar;57(3):349-54. doi: 10.1002/ana.20371.
• [18] Activation of the mammalian target of rapamycin signaling pathway underlies a novel inhibitory role of ring finger protein 182 in ventricular remodeling after myocardial ischemia-reperfusion injury.J Cell Biochem. 2019 May;120(5):7635-7648. doi: 10.1002/jcb.28038. Epub 2018 Nov 18.
• [19] Heat shock protein 70 protects cardiomyocytes through suppressing SUMOylation and nucleus translocation of phosphorylated eukaryotic elongation factor 2 during myocardial ischemia and reperfusion.Apoptosis. 2017 May;22(5):608-625. doi: 10.1007/s10495-017-1355-5.
• [20] Engineering toxin-resistant therapeutic stem cells to treat brain tumors.Stem Cells. 2015 Feb;33(2):589-600. doi: 10.1002/stem.1874.
• [21] Reduction of the rate of protein translation in patients with myotonic dystrophy 2.J Neurosci. 2009 Jul 15;29(28):9042-9. doi: 10.1523/JNEUROSCI.1983-09.2009.
• [22] Overexpression of eukaryotic elongation factor eEF2 in gastrointestinal cancers and its involvement in G2/M progression in the cell cycle.Int J Oncol. 2009 May;34(5):1181-9.
• [23] MYCN amplified neuroblastoma requires the mRNA translation regulator eEF2 kinase to adapt to nutrient deprivation.Cell Death Differ. 2017 Sep;24(9):1564-1576. doi: 10.1038/cdd.2017.79. Epub 2017 Jun 2.
• [24] Mitochondrial dysregulation of osteoarthritic human articular chondrocytes analyzed by proteomics: a decrease in mitochondrial superoxide dismutase points to a redox imbalance.Mol Cell Proteomics. 2009 Jan;8(1):172-89. doi: 10.1074/mcp.M800292-MCP200. Epub 2008 Sep 9.
• [25] Altered machinery of protein synthesis is region- and stage-dependent and is associated with -synuclein oligomers in Parkinson's disease.Acta Neuropathol Commun. 2015 Dec 1;3:76. doi: 10.1186/s40478-015-0257-4.
• [26] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [27] Proteomics investigations of drug-induced hepatotoxicity in HepG2 cells. Toxicol Sci. 2011 Mar;120(1):109-22.
• [28] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [29] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [30] Quantitative Assessment of Arsenite-Induced Perturbation of Ubiquitinated Proteome. Chem Res Toxicol. 2022 Sep 19;35(9):1589-1597. doi: 10.1021/acs.chemrestox.2c00197. Epub 2022 Aug 22.
• [31] Proteomic and functional analyses reveal a dual molecular mechanism underlying arsenic-induced apoptosis in human multiple myeloma cells. J Proteome Res. 2009 Jun;8(6):3006-19.
• [32] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [33] Effects of paclitaxel on proliferation and apoptosis in human acute myeloid leukemia HL-60 cells. Acta Pharmacol Sin. 2004 Mar;25(3):378-84.
• [34] Sumoylation of eukaryotic elongation factor 2 is vital for protein stability and anti-apoptotic activity in lung adenocarcinoma cells. Cancer Sci. 2011 Aug;102(8):1582-9. doi: 10.1111/j.1349-7006.2011.01975.x. Epub 2011 Jun 23.
• [35] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [36] Proteomics analysis of human umbilical vein endothelial cells treated with resveratrol. Amino Acids. 2012 Oct;43(4):1671-8. doi: 10.1007/s00726-012-1248-4. Epub 2012 Feb 18.
• [37] Changes in gene expressions elicited by physiological concentrations of genistein on human endometrial cancer cells. Mol Carcinog. 2006 Oct;45(10):752-63.
• [38] Impact of Heat Shock Protein 90 Inhibition on the Proteomic Profile of Lung Adenocarcinoma as Measured by Two-Dimensional Electrophoresis Coupled with Mass Spectrometry. Cells. 2019 Jul 31;8(8):806. doi: 10.3390/cells8080806.
• [39] Poly(ADP-ribose) glycohydrolase silencing down-regulates TCTP and Cofilin-1 associated with metastasis in benzo(a)pyrene carcinogenesis. Am J Cancer Res. 2014 Dec 15;5(1):155-67. eCollection 2015.
• [40] Targeting MYCN in neuroblastoma by BET bromodomain inhibition. Cancer Discov. 2013 Mar;3(3):308-23.
• [41] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [42] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [43] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [44] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [45] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [46] Lipid Rafts Disruption Increases Ochratoxin A Cytotoxicity to Hepatocytes. J Biochem Mol Toxicol. 2016 Feb;30(2):71-9. doi: 10.1002/jbt.21738. Epub 2015 Aug 25.
• [47] Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
• [48] Evaluation of an in vitro model of androgen ablation and identification of the androgen responsive proteome in LNCaP cells. Proteomics. 2007 Jan;7(1):47-63.
• [49] ST1926, a novel and orally active retinoid-related molecule inducing apoptosis in myeloid leukemia cells: modulation of intracellular calcium homeostasis. Blood. 2004 Jan 1;103(1):194-207.
• [50] La-related Protein 1 (LARP1) Represses Terminal Oligopyrimidine (TOP) mRNA Translation Downstream of mTOR Complex 1 (mTORC1). J Biol Chem. 2015 Jun 26;290(26):15996-6020. doi: 10.1074/jbc.M114.621730. Epub 2015 May 4.
• [51] Sumoylation of eukaryotic elongation factor 2 is vital for protein stability and anti-apoptotic activity in lung adenocarcinoma cells. Cancer Sci. 2011 Aug;102(8):1582-9. doi: 10.1111/j.1349-7006.2011.01975.x. Epub 2011 Jun 23.