Details of the Drug

General Information of Drug (ID: DMCN61Z)

Drug Name

Interferon beta-1b

Synonyms

Betaferon (TN); Betaseron (TN)

Indication

Disease Entry	ICD 11	Status	REF
Multiple sclerosis	8A40	Approved	[1]
------------------------------------------------------------------------------------

Therapeutic Class

Immunomodulatory Agents

Affected Organisms

Humans and other mammals

ATC Code

L03AB08: Interferon beta-1b

L03AB: Interferons

L03A: IMMUNOSTIMULANTS

L03: IMMUNOSTIMULANTS

L: ANTINEOPLASTIC AND IMMUNOMODULATING AGENTS

Sequence

SYNLLGFLQRSSNFQSQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYE
MLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLH
LKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN

ADMET Property

Vd: The volume of distribution (Vd) of drug is 0.25-2.88 L/kg []

Cross-matching ID

UNII: TTD90R31WZ
DrugBank ID: DB00068
TTD ID: D0CQ2O

Combinatorial Drugs (CBD)

Click to Jump to the Detailed CBD Information of This Drug

Molecular Interaction Atlas of This Drug

Drug Therapeutic Target (DTT)

DTT Name	DTT ID	UniProt ID	MOA	REF
Interferon alpha/beta receptor 2 (IFNAR2)	TTMQB37	INAR2_HUMAN	Binder	[2]

------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Same Disease as Interferon beta-1b

DDI Drug Name	DDI Drug ID	Severity	Mechanism	Disease	REF
Tecfidera	DM2OVDT	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Tecfidera.	Multiple sclerosis [8A40]	[3]
Siponimod	DM2R86O	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Siponimod.	Multiple sclerosis [8A40]	[3]
Fingolimod	DM5JVAN	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Fingolimod.	Multiple sclerosis [8A40]	[3]
Ozanimod	DMT6AM2	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Ozanimod.	Multiple sclerosis [8A40]	[3]
-----------

Coadministration of a Drug Treating the Disease Different from Interferon beta-1b (Comorbidity)

DDI Drug Name	DDI Drug ID	Severity	Mechanism	Comorbidity	REF
Remdesivir	DMBFZ6L	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Remdesivir.	1D6YCoronavirus Disease 2019 [1D6YCoronavirus Disease 2019]	[4]
Tretinoin	DM49DUI	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Tretinoin.	Acne vulgaris [ED80]	[3]
Isotretinoin	DM4QTBN	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Isotretinoin.	Acne vulgaris [ED80]	[3]
Nicotinamide	DMUPE07	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Nicotinamide.	Acquired cutaneous blood vessel malformation [EF20]	[5]
Troglitazone	DM3VFPD	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Troglitazone.	Acute diabete complication [5A2Y]	[3]
Pioglitazone	DMKJ485	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Pioglitazone.	Acute diabete complication [5A2Y]	[3]
Acarbose	DMRM3AW	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Acarbose.	Acute diabete complication [5A2Y]	[3]
Thioguanine	DM7NKEV	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Thioguanine.	Acute myeloid leukaemia [2A60]	[5]
Tagraxofusp	DM9HQ5U	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Tagraxofusp.	Acute myeloid leukaemia [2A60]	[3]
Gilteritinib	DMTI0ZO	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Gilteritinib.	Acute myeloid leukaemia [2A60]	[3]
Chlorzoxazone	DMCYVDT	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Chlorzoxazone.	Acute pain [MG31]	[3]
Oxandrolone	DMU9MYJ	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Oxandrolone.	Alcoholic liver disease [DB94]	[3]
Tacrine	DM51FY6	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Tacrine.	Alzheimer disease [8A20]	[3]
Inotersen	DMJ93CT	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Inotersen.	Amyloidosis [5D00]	[3]
Dronedarone	DMA8FS5	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Dronedarone.	Angina pectoris [BA40]	[3]
Bedaquiline	DM3906J	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Bedaquiline.	Antimicrobial drug resistance [MG50-MG52]	[6]
Oxymetholone	DMFXUT8	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Oxymetholone.	Aplastic anaemia [3A70]	[3]
Voriconazole	DMAOL2S	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Voriconazole.	Aspergillosis [1F20]	[3]
Zafirlukast	DMHNQOG	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Zafirlukast.	Asthma [CA23]	[3]
Aminophylline	DML2NIB	Moderate	Decreased metabolism of Interferon beta-1b caused by Aminophylline mediated inhibition of CYP450 enzyme.	Asthma [CA23]	[4]
Zileuton	DMVRIC2	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Zileuton.	Asthma [CA23]	[3]
Atomoxetine	DM5L6HI	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Atomoxetine.	Attention deficit hyperactivity disorder [6A05]	[3]
Clavulanate	DM2FGRT	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Clavulanate.	Bacterial infection [1A00-1C4Z]	[5]
Erythromycin	DM4K7GQ	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Erythromycin.	Bacterial infection [1A00-1C4Z]	[3]
Clarithromycin	DM4M1SG	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Clarithromycin.	Bacterial infection [1A00-1C4Z]	[3]
Trovafloxacin	DM6AN32	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Trovafloxacin.	Bacterial infection [1A00-1C4Z]	[3]
Sulfamethoxazole	DMB08GE	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Sulfamethoxazole.	Bacterial infection [1A00-1C4Z]	[3]
Levofloxacin	DMS60RB	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Levofloxacin.	Bacterial infection [1A00-1C4Z]	[3]
Moxifloxacin	DMU8V4S	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Moxifloxacin.	Bacterial infection [1A00-1C4Z]	[3]
Troleandomycin	DMUZNIG	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Troleandomycin.	Bacterial infection [1A00-1C4Z]	[3]
Minocycline	DMVN5OH	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Minocycline.	Bacterial infection [1A00-1C4Z]	[3]
Telithromycin	DMZ4P3A	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Telithromycin.	Bacterial infection [1A00-1C4Z]	[3]
Pexidartinib	DMS2J0Z	Major	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Pexidartinib.	Bone/articular cartilage neoplasm [2F7B]	[7]
Temozolomide	DMKECZD	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Temozolomide.	Brain cancer [2A00]	[3]
Lomustine	DMMWSUL	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Lomustine.	Brain cancer [2A00]	[3]
Lapatinib	DM3BH1Y	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Lapatinib.	Breast cancer [2C60-2C6Y]	[3]
LY2835219	DM93VBZ	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and LY2835219.	Breast cancer [2C60-2C6Y]	[3]
Pralatrexate	DMAO80I	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Pralatrexate.	Breast cancer [2C60-2C6Y]	[3]
Tucatinib	DMBESUA	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Tucatinib.	Breast cancer [2C60-2C6Y]	[3]
Tamoxifen	DMLB0EZ	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Tamoxifen.	Breast cancer [2C60-2C6Y]	[3]
Bosutinib	DMTI8YE	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Bosutinib.	Breast cancer [2C60-2C6Y]	[3]
Trastuzumab Emtansine	DMU1LXS	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Trastuzumab Emtansine.	Breast cancer [2C60-2C6Y]	[5]
Fluoxymesterone	DMUHCF1	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Fluoxymesterone.	Breast cancer [2C60-2C6Y]	[3]
Atorvastatin	DMF28YC	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Atorvastatin.	Cardiovascular disease [BA00-BE2Z]	[3]
Fenofibric acid	DMGO2MC	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Fenofibric acid.	Cardiovascular disease [BA00-BE2Z]	[3]
Macitentan	DMP79A1	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Macitentan.	Cardiovascular disease [BA00-BE2Z]	[3]
Chenodiol	DMQ8JIK	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Chenodiol.	Cholelithiasis [DC11]	[3]
Phenylbutazone	DMAYL0T	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Phenylbutazone.	Chronic pain [MG30]	[3]
Ketoprofen	DMRKXPT	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Ketoprofen.	Chronic pain [MG30]	[3]
Regorafenib	DMHSY1I	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Regorafenib.	Colorectal cancer [2B91]	[3]
Oxaliplatin	DMQNWRD	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Oxaliplatin.	Colorectal cancer [2B91]	[3]
Intedanib	DMSTA36	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Intedanib.	Colorectal cancer [2B91]	[3]
Oxtriphylline	DMLHSE3	Moderate	Decreased metabolism of Interferon beta-1b caused by Oxtriphylline mediated inhibition of CYP450 enzyme.	Cough [MD12]	[4]
Pasireotide	DMHM7JS	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Pasireotide.	Cushing syndrome [5A70]	[3]
Ivacaftor	DMZC1HS	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Ivacaftor.	Cystic fibrosis [CA25]	[3]
Ethanol	DMDRQZU	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Ethanol.	Cystitis [GC00]	[3]
Nefazodone	DM4ZS8M	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Nefazodone.	Depression [6A70-6A7Z]	[3]
Duloxetine	DM9BI7M	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Duloxetine.	Depression [6A70-6A7Z]	[3]
Milnacipran	DMBFE74	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Milnacipran.	Depression [6A70-6A7Z]	[3]
Polatuzumab vedotin	DMF6Y0L	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Polatuzumab vedotin.	Diffuse large B-cell lymphoma [2A81]	[3]
PMID28454500-Compound-96	DM2A75P	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and PMID28454500-Compound-96.	Discovery agent [N.A.]	[3]
PMID28870136-Compound-48	DMPIM9L	Moderate	Decreased metabolism of Interferon beta-1b caused by PMID28870136-Compound-48 mediated inhibition of CYP450 enzyme.	Discovery agent [N.A.]	[4]
Felbamate	DM1V5ZS	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Felbamate.	Epilepsy/seizure [8A61-8A6Z]	[3]
Mephenytoin	DM5UGDK	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Mephenytoin.	Epilepsy/seizure [8A61-8A6Z]	[3]
Valproate	DMCFE9I	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Valproate.	Epilepsy/seizure [8A61-8A6Z]	[3]
Phenytoin	DMNOKBV	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Phenytoin.	Epilepsy/seizure [8A61-8A6Z]	[3]
Fosphenytoin	DMOX3LB	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Fosphenytoin.	Epilepsy/seizure [8A61-8A6Z]	[3]
Ethotoin	DMXWOCP	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Ethotoin.	Epilepsy/seizure [8A61-8A6Z]	[3]
Carbamazepine	DMZOLBI	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Carbamazepine.	Epilepsy/seizure [8A61-8A6Z]	[3]
Cannabidiol	DM0659E	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Cannabidiol.	Epileptic encephalopathy [8A62]	[8]
Mefenamic acid	DMK7HFI	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Mefenamic acid.	Female pelvic pain [GA34]	[3]
Dantrolene	DM1D8XY	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Dantrolene.	Fever [MG26]	[3]
Itraconazole	DMCR1MV	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Itraconazole.	Fungal infection [1F29-1F2F]	[3]
Caspofungin	DMGQIPT	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Caspofungin.	Fungal infection [1F29-1F2F]	[3]
Terbinafine	DMI6HUW	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Terbinafine.	Fungal infection [1F29-1F2F]	[3]
Clotrimazole	DMMFCIH	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Clotrimazole.	Fungal infection [1F29-1F2F]	[3]
Fluconazole	DMOWZ6B	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Fluconazole.	Fungal infection [1F29-1F2F]	[3]
Ketoconazole	DMPZI3Q	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Ketoconazole.	Fungal infection [1F29-1F2F]	[3]
Atovaquone	DMY4UMW	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Atovaquone.	Fungal infection [1F29-1F2F]	[3]
Sunitinib	DMCBJSR	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Sunitinib.	Gastrointestinal stromal tumour [2B5B]	[3]
Ramipril	DM2R68E	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Ramipril.	Heart failure [BD10-BD1Z]	[3]
Interferon alfacon-1	DM90WJH	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Interferon alfacon-1.	Hepatitis virus infection [1E50-1E51]	[3]
Lamivudine	DMI347A	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Lamivudine.	Hepatitis virus infection [1E50-1E51]	[3]
177Lu-DOTATATE	DMT8GVU	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and 177Lu-DOTATATE.	Hepatitis virus infection [1E50-1E51]	[3]
Isoniazid	DM5JVS3	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Isoniazid.	HIV-infected patients with tuberculosis [1B10-1B14]	[3]
Rifampin	DMA8J1G	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Rifampin.	HIV-infected patients with tuberculosis [1B10-1B14]	[5]
Brentuximab vedotin	DMWLC57	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Brentuximab vedotin.	Hodgkin lymphoma [2B30]	[5]
Stavudine	DM6DEK9	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Stavudine.	Human immunodeficiency virus disease [1C60-1C62]	[3]
Nevirapine	DM6HX9B	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Nevirapine.	Human immunodeficiency virus disease [1C60-1C62]	[3]
Tipranavir	DM8HJX6	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Tipranavir.	Human immunodeficiency virus disease [1C60-1C62]	[3]
Emtricitabine	DMBMUWZ	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Emtricitabine.	Human immunodeficiency virus disease [1C60-1C62]	[3]
Efavirenz	DMC0GSJ	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Efavirenz.	Human immunodeficiency virus disease [1C60-1C62]	[3]
Zalcitabine	DMH7MUV	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Zalcitabine.	Human immunodeficiency virus disease [1C60-1C62]	[3]
Didanosine	DMI2QPE	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Didanosine.	Human immunodeficiency virus disease [1C60-1C62]	[3]
Rilpivirine	DMJ0QOW	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Rilpivirine.	Human immunodeficiency virus disease [1C60-1C62]	[3]
Abacavir	DMMN36E	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Abacavir.	Human immunodeficiency virus disease [1C60-1C62]	[3]
Darunavir	DMN3GCH	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Darunavir.	Human immunodeficiency virus disease [1C60-1C62]	[3]
Maraviroc	DMTL94F	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Maraviroc.	Human immunodeficiency virus disease [1C60-1C62]	[3]
Ritonavir	DMU764S	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Ritonavir.	Human immunodeficiency virus disease [1C60-1C62]	[3]
Simvastatin	DM30SGU	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Simvastatin.	Hyper-lipoproteinaemia [5C80]	[3]
Fluvastatin	DM4MDJY	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Fluvastatin.	Hyper-lipoproteinaemia [5C80]	[3]
Pravastatin	DM6A0X7	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Pravastatin.	Hyper-lipoproteinaemia [5C80]	[3]
Lovastatin	DM9OZWQ	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Lovastatin.	Hyper-lipoproteinaemia [5C80]	[3]
Fenofibrate	DMFKXDY	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Fenofibrate.	Hyper-lipoproteinaemia [5C80]	[3]
Mipomersen	DMGSRN1	Major	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Mipomersen.	Hyper-lipoproteinaemia [5C80]	[9]
Rosuvastatin	DMMIQ7G	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Rosuvastatin.	Hyper-lipoproteinaemia [5C80]	[3]
Teriflunomide	DMQ2FKJ	Major	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Teriflunomide.	Hyper-lipoproteinaemia [5C80]	[10]
BMS-201038	DMQTAGO	Major	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and BMS-201038.	Hyper-lipoproteinaemia [5C80]	[11]
Cerivastatin	DMXCM7H	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Cerivastatin.	Hyper-lipoproteinaemia [5C80]	[3]
Captopril	DM458UM	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Captopril.	Hypertension [BA00-BA04]	[3]
Trandolapril	DM4L6EU	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Trandolapril.	Hypertension [BA00-BA04]	[3]
Methyldopa	DM5I621	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Methyldopa.	Hypertension [BA00-BA04]	[3]
Fosinopril	DM9NJ52	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Fosinopril.	Hypertension [BA00-BA04]	[3]
Benazepril	DMH1M9B	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Benazepril.	Hypertension [BA00-BA04]	[3]
Labetalol	DMK8U72	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Labetalol.	Hypertension [BA00-BA04]	[3]
Enalapril	DMNFUZR	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Enalapril.	Hypertension [BA00-BA04]	[3]
Perindopril	DMOPZDT	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Perindopril.	Hypertension [BA00-BA04]	[3]
Quinapril	DMR8H31	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Quinapril.	Hypertension [BA00-BA04]	[3]
Lisinopril	DMUOK4C	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Lisinopril.	Hypertension [BA00-BA04]	[3]
Tolvaptan	DMIWFRL	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Tolvaptan.	Hypo-osmolality/hyponatraemia [5C72]	[3]
Pirfenidone	DM6VZFQ	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Pirfenidone.	Idiopathic interstitial pneumonitis [CB03]	[3]
Vitamin B3	DMQVRZH	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Vitamin B3.	Inborn lipid metabolism error [5C52]	[3]
Givosiran	DM5PFIJ	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Givosiran.	Inborn porphyrin/heme metabolism error [5C58]	[3]
Febuxostat	DMDEXQ0	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Febuxostat.	Inborn purine/pyrimidine/nucleotide metabolism error [5C55]	[3]
Meclofenamic acid	DM05FXR	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Meclofenamic acid.	Inflammatory spondyloarthritis [FA92]	[5]
Polyethylene glycol	DM4I1JP	Moderate	Increased risk of lowers seizure threshold by the combination of Interferon beta-1b and Polyethylene glycol.	Irritable bowel syndrome [DD91]	[12]
Methotrexate	DM2TEOL	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Methotrexate.	Leukaemia [2A60-2B33]	[8]
DTI-015	DMXZRW0	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and DTI-015.	Liver cancer [2C12]	[3]
Testosterone	DM7HUNW	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Testosterone.	Low bone mass disorder [FB83]	[3]
Crizotinib	DM4F29C	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Crizotinib.	Lung cancer [2C25]	[3]
Ceritinib	DMB920Z	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Ceritinib.	Lung cancer [2C25]	[3]
Erlotinib	DMCMBHA	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Erlotinib.	Lung cancer [2C25]	[3]
Lurbinectedin	DMEFRTZ	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Lurbinectedin.	Lung cancer [2C25]	[3]
Alectinib	DMP1I6Y	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Alectinib.	Lung cancer [2C25]	[3]
BIBW 2992	DMTKD7Q	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and BIBW 2992.	Lung cancer [2C25]	[3]
Pralsetinib	DMWU0I2	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Pralsetinib.	Lung cancer [2C25]	[3]
Capmatinib	DMYCXKL	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Capmatinib.	Lung cancer [2C25]	[3]
Selpercatinib	DMZR15V	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Selpercatinib.	Lung cancer [2C25]	[3]
Sulphadoxine	DMZI2UF	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Sulphadoxine.	Malaria [1F40-1F45]	[3]
Inotuzumab ozogamicin	DMAC130	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Inotuzumab ozogamicin.	Malignant haematopoietic neoplasm [2B33]	[3]
Calaspargase pegol	DMQZBXI	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Calaspargase pegol.	Malignant haematopoietic neoplasm [2B33]	[3]
Idelalisib	DM602WT	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Idelalisib.	Mature B-cell leukaemia [2A82]	[13]
IPI-145	DMWA24P	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and IPI-145.	Mature B-cell leukaemia [2A82]	[3]
Clofarabine	DMCVJ86	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Clofarabine.	Mature B-cell lymphoma [2A85]	[14]
Blinatumomab	DMGECIJ	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Blinatumomab.	Mature B-cell lymphoma [2A85]	[3]
Vincristine	DMINOX3	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Vincristine.	Mature B-cell lymphoma [2A85]	[3]
Mercaptopurine	DMTM2IK	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Mercaptopurine.	Mature B-cell lymphoma [2A85]	[3]
Ponatinib	DMYGJQO	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Ponatinib.	Mature B-cell lymphoma [2A85]	[3]
Cytarabine	DMZD5QR	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Cytarabine.	Mature B-cell lymphoma [2A85]	[3]
Arry-162	DM1P6FR	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Arry-162.	Melanoma [2C30]	[3]
Vemurafenib	DM62UG5	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Vemurafenib.	Melanoma [2C30]	[3]
Ipilimumab	DMJTIYK	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Ipilimumab.	Melanoma [2C30]	[3]
Dacarbazine	DMNPZL4	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Dacarbazine.	Melanoma [2C30]	[3]
Interferon alfa-2B	DMWCQP4	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Interferon alfa-2B.	Melanoma [2C30]	[3]
Danazol	DML8KTN	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Danazol.	Menstrual cycle bleeding disorder [GA20]	[3]
Exjade	DMHPRWG	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Exjade.	Mineral absorption/transport disorder [5C64]	[3]
Riluzole	DMECBWN	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Riluzole.	Motor neuron disease [8B60]	[3]
Carfilzomib	DM48K0X	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Carfilzomib.	Multiple myeloma [2A83]	[3]
Panobinostat	DM58WKG	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Panobinostat.	Multiple myeloma [2A83]	[3]
Lenalidomide	DM6Q7U4	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Lenalidomide.	Multiple myeloma [2A83]	[3]
Elotuzumab	DMEYHG9	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Elotuzumab.	Multiple myeloma [2A83]	[3]
Bortezomib	DMNO38U	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Bortezomib.	Multiple myeloma [2A83]	[3]
Pyrazinamide	DM4IF32	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Pyrazinamide.	Mycobacterium infection [1B10-1B21]	[3]
Bexarotene	DMOBIKY	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Bexarotene.	Mycosis fungoides [2B01]	[3]
Fedratinib	DM4ZBK6	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Fedratinib.	Myeloproliferative neoplasm [2A20]	[3]
Nilotinib	DM7HXWT	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Nilotinib.	Myeloproliferative neoplasm [2A20]	[3]
Imatinib	DM7RJXL	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Imatinib.	Myeloproliferative neoplasm [2A20]	[3]
Bupropion	DM5PCS7	Major	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Bupropion.	Nicotine use disorder [6C4A]	[3]
Entrectinib	DMMPTLH	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Entrectinib.	Non-small cell lung cancer [2C25]	[3]
Orlistat	DMRJSP8	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Orlistat.	Obesity [5B80-5B81]	[3]
Rofecoxib	DM3P5DA	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Rofecoxib.	Osteoarthritis [FA00-FA05]	[3]
Valdecoxib	DMAY7H4	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Valdecoxib.	Osteoarthritis [FA00-FA05]	[3]
Diclofenac	DMPIHLS	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Diclofenac.	Osteoarthritis [FA00-FA05]	[3]
Naproxen	DMZ5RGV	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Naproxen.	Osteoarthritis [FA00-FA05]	[3]
Ibuprofen	DM8VCBE	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Ibuprofen.	Pain [MG30-MG3Z]	[3]
Nabumetone	DMAT2XH	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Nabumetone.	Pain [MG30-MG3Z]	[3]
Tramadol	DMRQD04	Major	Increased risk of lowers seizure threshold by the combination of Interferon beta-1b and Tramadol.	Pain [MG30-MG3Z]	[15]
Piroxicam	DMTK234	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Piroxicam.	Pain [MG30-MG3Z]	[3]
Acetaminophen	DMUIE76	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Acetaminophen.	Pain [MG30-MG3Z]	[3]
Tolcapone	DM8MNVO	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Tolcapone.	Parkinsonism [8A00]	[3]
Ropinirole	DMA6S1D	Moderate	Decreased metabolism of Interferon beta-1b caused by Ropinirole mediated inhibition of CYP450 enzyme.	Parkinsonism [8A00]	[16]
Lindane	DMB8CNL	Moderate	Increased risk of lowers seizure threshold by the combination of Interferon beta-1b and Lindane.	Pediculosis [1G00]	[17]
Ketorolac	DMI4EL5	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Ketorolac.	Postoperative inflammation [1A00-CA43]	[3]
Bromfenac	DMKB79O	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Bromfenac.	Postoperative inflammation [1A00-CA43]	[3]
ABIRATERONE	DM8V75C	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and ABIRATERONE.	Prostate cancer [2C82]	[3]
Nilutamide	DMFN07X	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Nilutamide.	Prostate cancer [2C82]	[3]
Flutamide	DMK0O7U	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Flutamide.	Prostate cancer [2C82]	[3]
Bicalutamide	DMZMSPF	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Bicalutamide.	Prostate cancer [2C82]	[3]
Acitretin	DM8BKU9	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Acitretin.	Psoriasis [EA90]	[3]
Ambrisentan	DMD1QXW	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Ambrisentan.	Pulmonary hypertension [BB01]	[3]
Bosentan	DMIOGBU	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Bosentan.	Pulmonary hypertension [BB01]	[3]
Axitinib	DMGVH6N	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Axitinib.	Renal cell carcinoma [2C90]	[3]
Sorafenib	DMS8IFC	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Sorafenib.	Renal cell carcinoma [2C90]	[3]
Sulfadiazine	DMTW3R8	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Sulfadiazine.	Rheumatic fever [1B40]	[3]
Meloxicam	DM2AR7L	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Meloxicam.	Rheumatoid arthritis [FA20]	[3]
Sulindac	DM2QHZU	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Sulindac.	Rheumatoid arthritis [FA20]	[3]
Celecoxib	DM6LOQU	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Celecoxib.	Rheumatoid arthritis [FA20]	[3]
Tocilizumab	DM7J6OR	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Tocilizumab.	Rheumatoid arthritis [FA20]	[3]
Oxaprozin	DM9UB0P	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Oxaprozin.	Rheumatoid arthritis [FA20]	[3]
Flurbiprofen	DMGN4BY	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Flurbiprofen.	Rheumatoid arthritis [FA20]	[3]
Sulfasalazine	DMICA9H	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Sulfasalazine.	Rheumatoid arthritis [FA20]	[3]
Fenoprofen	DML5VQ0	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Fenoprofen.	Rheumatoid arthritis [FA20]	[3]
Sarilumab	DMOGNXY	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Sarilumab.	Rheumatoid arthritis [FA20]	[3]
Leflunomide	DMR8ONJ	Major	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Leflunomide.	Rheumatoid arthritis [FA20]	[10]
Indomethacin	DMSC4A7	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Indomethacin.	Rheumatoid arthritis [FA20]	[3]
Tolmetin	DMWUIJE	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Tolmetin.	Rheumatoid arthritis [FA20]	[3]
Pimozide	DMW83TP	Moderate	Decreased metabolism of Interferon beta-1b caused by Pimozide mediated inhibition of CYP450 enzyme.	Schizophrenia [6A20]	[18]
Gefitinib	DM15F0X	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Gefitinib.	Solid tumour/cancer [2A00-2F9Z]	[3]
Larotrectinib	DM26CQR	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Larotrectinib.	Solid tumour/cancer [2A00-2F9Z]	[3]
PDX-101	DM6OC53	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and PDX-101.	Solid tumour/cancer [2A00-2F9Z]	[3]
Trabectedin	DMG3Y89	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Trabectedin.	Solid tumour/cancer [2A00-2F9Z]	[3]
LEE011	DMMX75K	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and LEE011.	Solid tumour/cancer [2A00-2F9Z]	[3]
Epirubicin	DMPDW6T	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Epirubicin.	Solid tumour/cancer [2A00-2F9Z]	[4]
Methyltestosterone	DMWLFGO	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Methyltestosterone.	Solid tumour/cancer [2A00-2F9Z]	[3]
Disulfiram	DMCL2OK	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Disulfiram.	Substance abuse [6C40]	[3]
Naltrexone	DMUL45H	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Naltrexone.	Substance abuse [6C40]	[3]
Zithromax	DMN4H2O	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Zithromax.	Syphilis [1A61-1A6Z]	[3]
Fostamatinib	DM6AUHV	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Fostamatinib.	Thrombocytopenia [3B64]	[3]
Eltrombopag	DMOGFIX	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Eltrombopag.	Thrombocytopenia [3B64]	[3]
Lenvatinib	DMB1IU4	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Lenvatinib.	Thyroid cancer [2D10]	[3]
Methimazole	DM25FL8	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Methimazole.	Thyrotoxicosis [5A02]	[3]
Propylthiouracil	DM6D7N8	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Propylthiouracil.	Thyrotoxicosis [5A02]	[3]
Tizanidine	DMR2IQ4	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Tizanidine.	Tonus and reflex abnormality [MB47]	[3]
Trimetrexate	DMDEA85	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Trimetrexate.	Toxoplasmosis [1F57]	[3]
Azathioprine	DMMZSXQ	Moderate	Additive immunosuppressive effects by the combination of Interferon beta-1b and Azathioprine.	Transplant rejection [NE84]	[4]
Aminosalicylic acid	DMENSL5	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Aminosalicylic acid.	Tuberculosis [1B10-1B12]	[3]
Ethambutol	DMR87LC	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Ethambutol.	Tuberculosis [1B10-1B12]	[3]
Nitrofurantoin	DM7PQIK	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Nitrofurantoin.	Urinary tract infection [GC08]	[3]
Sulfamethizole	DMGCHDS	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Sulfamethizole.	Urinary tract infection [GC08]	[3]
Sulfisoxazole	DMXLT8C	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Sulfisoxazole.	Urinary tract infection [GC08]	[3]
Elagolix	DMB2C0E	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Elagolix.	Uterine fibroid [2E86]	[3]
Amiodarone	DMUTEX3	Moderate	Increased risk of hepatotoxicity by the combination of Interferon beta-1b and Amiodarone.	Ventricular tachyarrhythmia [BC71]	[3]
-----------


⏷ Show the Full List of 232 DDI Information of This Drug

References

1	Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77.
2	Interferon-beta(1b) Treatment in Neuromyelitis Optica. Eur Neurol. 2009 Jul 7;62(3):167-170.
3	Product Information. Avonex (interferon beta-1a). Biogen, Cambridge, MA.
4	Cerner Multum, Inc. "Australian Product Information.".
5	Product Information. Betaseron (interferon beta-1b). Berlex, Richmond, CA.
6	Product Information. Sirturo (bedaquiline). Janssen Pharmaceuticals, Titusville, NJ.
7	Product Information. Turalio (pexidartinib). Daiichi Sankyo, Inc., Parsippany, NJ.
8	Cerner Multum, Inc. "UK Summary of Product Characteristics.".
9	Product Information. Kynamro (mipomersen). Genzyme Corporation, Cambridge, MA.
10	Canadian Pharmacists Association.
11	Product Information. Juxtapid (lomitapide). Aegerion Pharmaceuticals Inc, Cambridge, MA.
12	Product Information. Suprep Bowel Prep Kit (magnesium/potassium/sodium sulfates). Braintree Laboratories, Braintree, MA.
13	Product Information. Zydelig (idelalisib). Gilead Sciences, Foster City, CA.
14	Product Information. Clolar (clofarabine). sanofi-aventis, Bridgewater, NJ.
15	Product Information. Ultram (tramadol). McNeil Pharmaceutical, Raritan, NJ.
16	Product Information. Noroxin (norfloxacin). Merck & Co, Inc, West Point, PA.
17	Matsuoka LY "Convulsions following application of gamma benzene hexachloride." J Am Acad Dermatol 5 (1981): 98-9. [PMID: 6168673]
18	Krahenbuhl S, Sauter B, Kupferschmidt H, Krause M, Wyss PA, Meier PJ "Case report: reversible QT prolongation with torsades de pointes in a patient with pimozide intoxication." Am J Med Sci 309 (1995): 315-6. [PMID: 7771501]