Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT04IG2N)

• DOT Name: Small integral membrane protein 10-like protein 2A (SMIM10L2B)
• Gene Name: SMIM10L2B
• Related Disease:
  Acne vulgaris
  Actinic keratosis
  Advanced cancer
  Alzheimer disease
  Anemia
  Atopic dermatitis
  Atrial fibrillation
  Atypical teratoid/rhabdoid tumour
  B-cell neoplasm
  Depression
  Disorder of orbital region
  Hepatitis C virus infection
  Latent tuberculosis infection
  Neoplasm
  Periodontal disease
  Refractive error
  Tuberculosis
  Extrapulmonary tuberculosis
  Gastric cancer
  Oral cancer
  Stomach cancer
  Type-1/2 diabetes
  Breast cancer
  Breast carcinoma
  Dental caries
  Malaria
  Melanoma
  Melorheostosis
  Nasopharyngeal carcinoma
  Posterior urethral valve
  Pulmonary tuberculosis
  Squamous cell carcinoma
  Stroke
• UniProt ID: SIL2A_HUMAN
• Pfam ID: PF15118
• Sequence:
  MAASAALSAAAAAAALSGLAVRLSRSAAARGSYGAFCKGLTRTLLTFFDLAWRLRMNFPY
  FYIVASVMLNVRLQVRIE

Molecular Interaction Atlas (MIA) of This DOT

33 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acne vulgaris	DISKW8PI	Strong	Genetic Variation	[1]
Actinic keratosis	DISR1RC5	Strong	Biomarker	[2]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[3]
Alzheimer disease	DISF8S70	Strong	Altered Expression	[4]
Anemia	DISTVL0C	Strong	Biomarker	[5]
Atopic dermatitis	DISTCP41	Strong	Biomarker	[6]
Atrial fibrillation	DIS15W6U	Strong	Biomarker	[7]
Atypical teratoid/rhabdoid tumour	DIS1FA0D	Strong	Biomarker	[8]
B-cell neoplasm	DISVY326	Strong	Biomarker	[9]
Depression	DIS3XJ69	Strong	Biomarker	[10]
Disorder of orbital region	DISH0ECJ	Strong	Biomarker	[11]
Hepatitis C virus infection	DISQ0M8R	Strong	Genetic Variation	[5]
Latent tuberculosis infection	DIS6R1EH	Strong	Biomarker	[12]
Neoplasm	DISZKGEW	Strong	Biomarker	[13]
Periodontal disease	DISJQHVN	Strong	Biomarker	[14]
Refractive error	DISWNEQ1	Strong	Biomarker	[15]
Tuberculosis	DIS2YIMD	Strong	Biomarker	[12]
Extrapulmonary tuberculosis	DIS6KM28	moderate	Biomarker	[16]
Gastric cancer	DISXGOUK	moderate	Posttranslational Modification	[17]
Oral cancer	DISLD42D	moderate	Biomarker	[18]
Stomach cancer	DISKIJSX	moderate	Posttranslational Modification	[17]
Type-1/2 diabetes	DISIUHAP	Disputed	Biomarker	[19]
Breast cancer	DIS7DPX1	Limited	Biomarker	[20]
Breast carcinoma	DIS2UE88	Limited	Biomarker	[20]
Dental caries	DISRBCMD	Limited	Biomarker	[21]
Malaria	DISQ9Y50	Limited	Biomarker	[22]
Melanoma	DIS1RRCY	Limited	Biomarker	[23]
Melorheostosis	DISIMCL3	Limited	Biomarker	[23]
Nasopharyngeal carcinoma	DISAOTQ0	Limited	Altered Expression	[3]
Posterior urethral valve	DIS2UD2J	Limited	Biomarker	[24]
Pulmonary tuberculosis	DIS6FLUM	Limited	Biomarker	[25]
Squamous cell carcinoma	DISQVIFL	Limited	Biomarker	[26]
Stroke	DISX6UHX	Limited	Biomarker	[27]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Small integral membrane protein 10-like protein 2A (SMIM10L2B).	[28]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Small integral membrane protein 10-like protein 2A (SMIM10L2B).	[29]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Small integral membrane protein 10-like protein 2A (SMIM10L2B).	[30]
Estradiol	DMUNTE3	Approved	Estradiol affects the expression of Small integral membrane protein 10-like protein 2A (SMIM10L2B).	[31]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil decreases the expression of Small integral membrane protein 10-like protein 2A (SMIM10L2B).	[32]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Small integral membrane protein 10-like protein 2A (SMIM10L2B).	[33]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Small integral membrane protein 10-like protein 2A (SMIM10L2B).	[34]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Small integral membrane protein 10-like protein 2A (SMIM10L2B).	[35]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Small integral membrane protein 10-like protein 2A (SMIM10L2B).	[36]

References

• [1] Propionibacterium acnes susceptibility to low-level 449nm blue light photobiomodulation.Lasers Surg Med. 2019 Oct;51(8):727-734. doi: 10.1002/lsm.23087. Epub 2019 Mar 28.
• [2] Split-face study comparing conventional MAL photodynamic therapy in multiple actinic keratosis with complete time vs. half-time red light LED conventional illumination.J Eur Acad Dermatol Venereol. 2019 Aug;33(8):1529-1534. doi: 10.1111/jdv.15566. Epub 2019 Apr 15.
• [3] Long Noncoding RNA LINC0086 Functions as a Tumor Suppressor in Nasopharyngeal Carcinoma by Targeting miR-214.Oncol Res. 2017 Aug 7;25(7):1189-1197. doi: 10.3727/096504017X14865126670075. Epub 2017 Feb 13.
• [4] microRNA-34a (miRNA-34a) Mediated Down-Regulation of the Post-synaptic Cytoskeletal Element SHANK3 in Sporadic Alzheimer's Disease (AD).Front Neurol. 2019 Feb 6;10:28. doi: 10.3389/fneur.2019.00028. eCollection 2019.
• [5] Ledipasvir/sofosbuvir with or without ribavirin for the treatment of chronic hepatitis C genotype 1: A pairwise meta-analysis.J Gastroenterol Hepatol. 2017 Apr;32(4):749-755. doi: 10.1111/jgh.13620.
• [6] Irradiation with 310 nm and 340 nm ultraviolet light-emitting-diodes can improve atopic dermatitis-like skin lesions in NC/Nga mice.Photochem Photobiol Sci. 2018 Aug 8;17(8):1127-1135. doi: 10.1039/c8pp00063h.
• [7] Smart detection of atrial fibrillation?"Krivoshei L. Burkard T
• [8] Influence of Quantum-Well Width on the Electroluminescence Properties of AlGaN Deep Ultraviolet Light-Emitting Diodes at Different Temperatures.Nanoscale Res Lett. 2018 Oct 23;13(1):334. doi: 10.1186/s11671-018-2756-2.
• [9] Blue light emitting diode induces apoptosis in lymphoid cells by stimulating autophagy.Int J Biochem Cell Biol. 2016 Jan;70:13-22. doi: 10.1016/j.biocel.2015.11.004. Epub 2015 Nov 10.
• [10] Low-Level Laser Therapy for Fibromyalgia: A Systematic Review and Meta-Analysis.Pain Physician. 2019 May;22(3):241-254.
• [11] Our experience with smartphone and spherical lens for the eye fundus examination during humanitarian project in Africa.Int J Ophthalmol. 2017 Jan 18;10(1):157-160. doi: 10.18240/ijo.2017.01.25. eCollection 2017.
• [12] Comparison of loop-mediated isothermal amplification assay and smear microscopy with culture for the diagnostic accuracy of tuberculosis.BMC Infect Dis. 2017 Jan 17;17(1):79. doi: 10.1186/s12879-016-2140-8.
• [13] Evaluation of the accuracy of the CyberKnife Synchrony?Respiratory Tracking System using a plastic scintillator.Med Phys. 2018 Jun 1. doi: 10.1002/mp.13028. Online ahead of print.
• [14] In- vitro-activity of additive application of hydrogen peroxide in antimicrobial photodynamic therapy using LED in the blue spectrum against bacteria and biofilm associated with periodontal disease.Photodiagnosis Photodyn Ther. 2019 Jun;26:306-312. doi: 10.1016/j.pdpdt.2019.04.015. Epub 2019 Apr 16.
• [15] Demyelination and shrinkage of axons in the retinal nerve fiber layer in chickens developing deprivation myopia.Exp Eye Res. 2019 Nov;188:107783. doi: 10.1016/j.exer.2019.107783. Epub 2019 Aug 29.
• [16] Comparison of GeneXpert MTB/RIF assay and LED-FM microscopy for the diagnosis of extra pulmonary tuberculosis in Khyber Pakhtunkhwa, Pakistan.Braz J Microbiol. 2018 Oct-Dec;49(4):909-913. doi: 10.1016/j.bjm.2018.02.011. Epub 2018 Apr 27.
• [17] DNA methylation contributes to silencing the expression of linc00086 in gastric cancer.Oncol Lett. 2018 Aug;16(2):1931-1936. doi: 10.3892/ol.2018.8868. Epub 2018 Jun 1.
• [18] Development and evaluation of a low-cost, portable, LED-based device for PDT treatment of early-stage oral cancer in resource-limited settings.Lasers Surg Med. 2019 Apr;51(4):345-351. doi: 10.1002/lsm.23019. Epub 2018 Aug 31.
• [19] Antimicrobial photodynamic therapy (aPDT) with curcumin and LED, as an enhancement to scaling and root planing in the treatment of residual pockets in diabetic patients: A randomized and controlled split-mouth clinical trial.Photodiagnosis Photodyn Ther. 2019 Sep;27:388-395. doi: 10.1016/j.pdpdt.2019.07.005. Epub 2019 Jul 10.
• [20] Low power blue LED exposure increases effects of doxorubicin on MDA-MB-231 breast cancer cells.Photodiagnosis Photodyn Ther. 2018 Dec;24:250-255. doi: 10.1016/j.pdpdt.2018.07.016. Epub 2018 Jul 29.
• [21] The impact of photobiomodulation of major salivary glands on caries risk.Lasers Med Sci. 2020 Feb;35(1):193-203. doi: 10.1007/s10103-019-02845-x. Epub 2019 Jul 19.
• [22] LED fluorescence microscopy: Novel method for malaria diagnosis compared with routine methods.J Infect Public Health. 2017 Nov-Dec;10(6):824-828. doi: 10.1016/j.jiph.2017.01.001. Epub 2017 Mar 6.
• [23] Specific Targeting of Melanotic Cells with Peptide Ligated Photosensitizers for Photodynamic Therapy.Sci Rep. 2017 Nov 16;7(1):15750. doi: 10.1038/s41598-017-15142-w.
• [24] Improvise, Adapt, Overcome: mobile phone LED used as a light source for cystoscopy and resection of posterior urethral valves in a low-cost setting.J Pediatr Urol. 2019 Feb;15(1):85-86. doi: 10.1016/j.jpurol.2018.11.012. Epub 2018 Nov 27.
• [25] Cost-effectiveness of GeneXpert and LED-FM for diagnosis of pulmonary tuberculosis: A systematic review.PLoS One. 2018 Oct 29;13(10):e0205233. doi: 10.1371/journal.pone.0205233. eCollection 2018.
• [26] High energy density LED-based photobiomodulation inhibits squamous cell carcinoma progression in co-cultures in vitro.J Photochem Photobiol B. 2019 Oct;199:111592. doi: 10.1016/j.jphotobiol.2019.111592. Epub 2019 Aug 14.
• [27] Comparing two randomized deep brain stimulation trials for Parkinson's disease.J Neurosurg. 2019 Apr 5;132(5):1376-1384. doi: 10.3171/2018.12.JNS182042.
• [28] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [29] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [30] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [31] Identification of novel low-dose bisphenol a targets in human foreskin fibroblast cells derived from hypospadias patients. PLoS One. 2012;7(5):e36711. doi: 10.1371/journal.pone.0036711. Epub 2012 May 4.
• [32] New insights into the mechanisms underlying 5-fluorouracil-induced intestinal toxicity based on transcriptomic and metabolomic responses in human intestinal organoids. Arch Toxicol. 2021 Aug;95(8):2691-2718. doi: 10.1007/s00204-021-03092-2. Epub 2021 Jun 20.
• [33] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [34] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [35] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [36] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.