Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT0NOWU2)

DOT Name Homeobox protein Hox-D10 (HOXD10)
Synonyms Homeobox protein Hox-4D; Homeobox protein Hox-4E
Gene Name HOXD10
Related Disease
Head-neck squamous cell carcinoma ( )
Thyroid gland papillary carcinoma ( )
Acute myelogenous leukaemia ( )
Advanced cancer ( )
Bladder cancer ( )
Breast cancer ( )
Breast carcinoma ( )
Breast neoplasm ( )
Carcinoma ( )
Charcot marie tooth disease ( )
Charcot-Marie-Tooth disease type 1 ( )
Charcot-Marie-Tooth disease type 1A ( )
Charcot-Marie-Tooth disease type 1B ( )
Charcot-Marie-Tooth disease type 2 ( )
Cholangiocarcinoma ( )
Colon cancer ( )
Colon carcinoma ( )
Congestive heart failure ( )
Esophageal squamous cell carcinoma ( )
Gastric cancer ( )
Glioma ( )
Head and neck cancer ( )
Head and neck carcinoma ( )
Hepatocellular carcinoma ( )
Intervertebral disc degeneration ( )
Non-small-cell lung cancer ( )
Prostate cancer ( )
Prostate carcinoma ( )
Prostate neoplasm ( )
Rheumatoid arthritis ( )
Stomach cancer ( )
Urinary bladder cancer ( )
Urinary bladder neoplasm ( )
Wilms tumor ( )
Adult glioblastoma ( )
Amyotrophic lateral sclerosis type 1 ( )
Colorectal carcinoma ( )
Congenital vertical talus ( )
Epithelial ovarian cancer ( )
Glioblastoma multiforme ( )
Invasive ductal breast carcinoma ( )
Neoplasm ( )
UniProt ID
HXD10_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00046
Sequence
MSFPNSSPAANTFLVDSLISACRSDSFYSSSASMYMPPPSADMGTYGMQTCGLLPSLAKR
EVNHQNMGMNVHPYIPQVDSWTDPNRSCRIEQPVTQQVPTCSFTTNIKEESNCCMYSDKR
NKLISAEVPSYQRLVPESCPVENPEVPVPGYFRLSQTYATGKTQEYNNSPEGSSTVMLQL
NPRGAAKPQLSAAQLQMEKKMNEPVSGQEPTKVSQVESPEAKGGLPEERSCLAEVSVSSP
EVQEKESKEEIKSDTPTSNWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEIS
KSVNLTDRQVKIWFQNRRMKLKKMSRENRIRELTANLTFS
Function Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Tissue Specificity Strongly expressed in the adult male and female urogenital tracts.
KEGG Pathway
Proteoglycans in cancer (hsa05205 )
MicroR.s in cancer (hsa05206 )

Molecular Interaction Atlas (MIA) of This DOT

42 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Head-neck squamous cell carcinoma DISF7P24 Definitive Altered Expression [1]
Thyroid gland papillary carcinoma DIS48YMM Definitive Posttranslational Modification [2]
Acute myelogenous leukaemia DISCSPTN Strong Biomarker [3]
Advanced cancer DISAT1Z9 Strong Biomarker [4]
Bladder cancer DISUHNM0 Strong Biomarker [5]
Breast cancer DIS7DPX1 Strong Altered Expression [6]
Breast carcinoma DIS2UE88 Strong Altered Expression [6]
Breast neoplasm DISNGJLM Strong Altered Expression [7]
Carcinoma DISH9F1N Strong Altered Expression [8]
Charcot marie tooth disease DIS3BT2L Strong Genetic Variation [9]
Charcot-Marie-Tooth disease type 1 DIS56F9A Strong Biomarker [10]
Charcot-Marie-Tooth disease type 1A DISSRZG7 Strong Biomarker [10]
Charcot-Marie-Tooth disease type 1B DISJRS1V Strong Biomarker [10]
Charcot-Marie-Tooth disease type 2 DISR30O9 Strong Biomarker [10]
Cholangiocarcinoma DIS71F6X Strong Altered Expression [11]
Colon cancer DISVC52G Strong Posttranslational Modification [12]
Colon carcinoma DISJYKUO Strong Posttranslational Modification [12]
Congestive heart failure DIS32MEA Strong Altered Expression [13]
Esophageal squamous cell carcinoma DIS5N2GV Strong Altered Expression [14]
Gastric cancer DISXGOUK Strong Biomarker [15]
Glioma DIS5RPEH Strong Biomarker [16]
Head and neck cancer DISBPSQZ Strong Biomarker [1]
Head and neck carcinoma DISOU1DS Strong Biomarker [1]
Hepatocellular carcinoma DIS0J828 Strong Posttranslational Modification [4]
Intervertebral disc degeneration DISG3AIM Strong Biomarker [17]
Non-small-cell lung cancer DIS5Y6R9 Strong Biomarker [18]
Prostate cancer DISF190Y Strong Biomarker [19]
Prostate carcinoma DISMJPLE Strong Biomarker [19]
Prostate neoplasm DISHDKGQ Strong Biomarker [19]
Rheumatoid arthritis DISTSB4J Strong Biomarker [20]
Stomach cancer DISKIJSX Strong Biomarker [15]
Urinary bladder cancer DISDV4T7 Strong Biomarker [5]
Urinary bladder neoplasm DIS7HACE Strong Biomarker [5]
Wilms tumor DISB6T16 Strong Altered Expression [21]
Adult glioblastoma DISVP4LU Limited Biomarker [22]
Amyotrophic lateral sclerosis type 1 DIS5A2M0 Limited Genetic Variation [23]
Colorectal carcinoma DIS5PYL0 Limited Biomarker [24]
Congenital vertical talus DISZF3HD Limited Autosomal dominant [25]
Epithelial ovarian cancer DIS56MH2 Limited Altered Expression [26]
Glioblastoma multiforme DISK8246 Limited Biomarker [22]
Invasive ductal breast carcinoma DIS43J58 Limited Biomarker [27]
Neoplasm DISZKGEW Limited Biomarker [14]
------------------------------------------------------------------------------------
⏷ Show the Full List of 42 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
5 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Homeobox protein Hox-D10 (HOXD10). [28]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Homeobox protein Hox-D10 (HOXD10). [29]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Homeobox protein Hox-D10 (HOXD10). [31]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of Homeobox protein Hox-D10 (HOXD10). [32]
Acetaldehyde DMJFKG4 Investigative Acetaldehyde increases the expression of Homeobox protein Hox-D10 (HOXD10). [33]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Homeobox protein Hox-D10 (HOXD10). [30]
------------------------------------------------------------------------------------

References

1 POU2F1 activity regulates HOXD10 and HOXD11 promoting a proliferative and invasive phenotype in head and neck cancer.Oncotarget. 2014 Sep 30;5(18):8803-15. doi: 10.18632/oncotarget.2492.
2 Aberrant hypermethylation of the HOXD10 gene in papillary thyroid cancer with BRAFV600E mutation.Oncol Rep. 2018 Jan;39(1):338-348. doi: 10.3892/or.2017.6058. Epub 2017 Oct 25.
3 MiR-10b regulates the proliferation and apoptosis of pediatric acute myeloid leukemia through targeting HOXD10.Eur Rev Med Pharmacol Sci. 2018 Nov;22(21):7371-7378. doi: 10.26355/eurrev_201811_16275.
4 Silencing HOXD10 by promoter region hypermethylation activates ERK signaling in hepatocellular carcinoma.Clin Epigenetics. 2017 Oct 23;9:116. doi: 10.1186/s13148-017-0412-9. eCollection 2017.
5 MicroRNA-10b promotes migration and invasion through KLF4 and HOXD10 in human bladder cancer.Oncol Rep. 2014 Apr;31(4):1832-8. doi: 10.3892/or.2014.3048. Epub 2014 Feb 24.
6 RNA Binding Protein RNPC1 Inhibits Breast Cancer Cell Metastasis via Activating STARD13-Correlated ceRNA Network.Mol Pharm. 2018 Jun 4;15(6):2123-2132. doi: 10.1021/acs.molpharmaceut.7b01123. Epub 2018 May 15.
7 Hyaluronan-CD44 interaction promotes c-Src-mediated twist signaling, microRNA-10b expression, and RhoA/RhoC up-regulation, leading to Rho-kinase-associated cytoskeleton activation and breast tumor cell invasion.J Biol Chem. 2010 Nov 19;285(47):36721-35. doi: 10.1074/jbc.M110.162305. Epub 2010 Sep 15.
8 Identification of a developmental gene expression signature, including HOX genes, for the normal human colonic crypt stem cell niche: overexpression of the signature parallels stem cell overpopulation during colon tumorigenesis.Stem Cells Dev. 2014 Jan 15;23(2):167-79. doi: 10.1089/scd.2013.0039. Epub 2013 Nov 5.
9 HOXD10 M319K mutation in a family with isolated congenital vertical talus.J Orthop Res. 2006 Mar;24(3):448-53. doi: 10.1002/jor.20052.
10 A HOX gene mutation in a family with isolated congenital vertical talus and Charcot-Marie-Tooth disease. Am J Hum Genet. 2004 Jul;75(1):92-6. doi: 10.1086/422015. Epub 2004 May 14.
11 HOXD10 acts as a tumor-suppressive factor via inhibition of the RHOC/AKT/MAPK pathway in human cholangiocellular carcinoma.Oncol Rep. 2015 Oct;34(4):1681-91. doi: 10.3892/or.2015.4194. Epub 2015 Aug 10.
12 Epigenetic inactivation of HOXD10 is associated with human colon cancer via inhibiting the RHOC/AKT/MAPK signaling pathway.Cell Commun Signal. 2019 Jan 25;17(1):9. doi: 10.1186/s12964-018-0316-0.
13 Sympathoexcitation in Rats With Chronic Heart Failure Depends on Homeobox D10 and MicroRNA-7b Inhibiting GABBR1 Translation in Paraventricular Nucleus.Circ Heart Fail. 2016 Jan;9(1):e002261. doi: 10.1161/CIRCHEARTFAILURE.115.002261. Epub 2015 Dec 23.
14 Homeobox D10, a tumor suppressor, inhibits the proliferation and migration of esophageal squamous cell carcinoma.J Cell Biochem. 2019 Aug;120(8):13717-13725. doi: 10.1002/jcb.28644. Epub 2019 Apr 2.
15 Combined Detection of Plasma ZIC1, HOXD10 and RUNX3 Methylation is a Promising Strategy for Early Detection of Gastric Cancer and Precancerous Lesions.J Cancer. 2017 Apr 8;8(6):1038-1044. doi: 10.7150/jca.18169. eCollection 2017.
16 MicroRNA-10b induces glioma cell invasion by modulating MMP-14 and uPAR expression via HOXD10.Brain Res. 2011 May 10;1389:9-18. doi: 10.1016/j.brainres.2011.03.013. Epub 2011 Mar 16.
17 MicroRNA-10b promotes nucleus pulposus cell proliferation through RhoC-Akt pathway by targeting HOXD10 in intervetebral disc degeneration.PLoS One. 2013 Dec 20;8(12):e83080. doi: 10.1371/journal.pone.0083080. eCollection 2013.
18 miR-224 enhances invasion and metastasis by targeting HOXD10 in non-small cell lung cancer cells.Oncol Lett. 2018 May;15(5):7069-7075. doi: 10.3892/ol.2018.8245. Epub 2018 Mar 12.
19 Decreased HoxD10 Expression Promotes a Proliferative and Aggressive Phenotype in Prostate Cancer.Curr Mol Med. 2017;17(1):70-78. doi: 10.2174/1566524017666170220104920.
20 HOXD10 silencing suppresses human fibroblast-like synoviocyte migration in rheumatoid arthritis via downregulation of the p38/JNK pathway.Exp Ther Med. 2018 Sep;16(3):1621-1628. doi: 10.3892/etm.2018.6432. Epub 2018 Jul 9.
21 Expression of AbdB-type homeobox genes in human tumors.Lab Invest. 1994 Nov;71(5):663-70.
22 miR-23a promotes invasion of glioblastoma via HOXD10-regulated glial-mesenchymal transition.Signal Transduct Target Ther. 2018 Dec 28;3:33. doi: 10.1038/s41392-018-0033-6. eCollection 2018.
23 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.Neurobiol Aging. 2014 Jul;35(7):1778.e9-1778.e23. doi: 10.1016/j.neurobiolaging.2014.01.014. Epub 2014 Jan 17.
24 Gene expression signatures for HOXA4, HOXA9, and HOXD10 reveal alterations in transcriptional regulatory networks in colon cancer.J Cell Physiol. 2019 Aug;234(8):13042-13056. doi: 10.1002/jcp.27975. Epub 2018 Dec 14.
25 Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
26 Loss of HOXD10 expression induced by upregulation of miR-10b accelerates the migration and invasion activities of ovarian cancer cells.Int J Oncol. 2013 Jul;43(1):63-71. doi: 10.3892/ijo.2013.1935. Epub 2013 May 13.
27 HOXD10 expression in human breast cancer.Tumour Biol. 2014 Nov;35(11):10855-60. doi: 10.1007/s13277-014-2324-z. Epub 2014 Aug 1.
28 The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
29 Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
30 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
31 Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
32 Cellular reactions to long-term volatile organic compound (VOC) exposures. Sci Rep. 2016 Dec 1;6:37842. doi: 10.1038/srep37842.
33 Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.