Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT2HZK5M)

DOT Name Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3)
Synonyms Glucose transporter type 3, brain; GLUT-3
Gene Name SLC2A3
UniProt ID
GTR3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
4ZW9; 4ZWB; 4ZWC; 5C65; 7CRZ; 7SPS; 7SPT
Pfam ID
PF00083
Sequence
MGTQKVTPALIFAITVATIGSFQFGYNTGVINAPEKIIKEFINKTLTDKGNAPPSEVLLT
SLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAVTGGCFMGLCKVAKSVEML
ILGRLVIGLFCGLCTGFVPMYIGEISPTALRGAFGTLNQLGIVVGILVAQIFGLEFILGS
EELWPLLLGFTILPAILQSAALPFCPESPRFLLINRKEEENAKQILQRLWGTQDVSQDIQ
EMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQLSGINAVFYYSTGIFKDAG
VQEPIYATIGAGVVNTIFTVVSLFLVERAGRRTLHMIGLGGMAFCSTLMTVSLLLKDNYN
GMSFVCIGAILVFVAFFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGLLF
PSAAHYLGAYVFIIFTGFLITFLAFTFFKVPETRGRTFEDITRAFEGQAHGADRSGKDGV
MEMNSIEPAKETTTNV
Function
Facilitative glucose transporter. Can also mediate the uptake of various other monosaccharides across the cell membrane. Mediates the uptake of glucose, 2-deoxyglucose, galactose, mannose, xylose and fucose, and probably also dehydroascorbate. Does not mediate fructose transport. Required for mesendoderm differentiation.
Tissue Specificity Highly expressed in brain . Expressed in many tissues.
Reactome Pathway
Vitamin C (ascorbate) metabolism (R-HSA-196836 )
Neutrophil degranulation (R-HSA-6798695 )
MECP2 regulates neuronal receptors and channels (R-HSA-9022699 )
Cellular hexose transport (R-HSA-189200 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 1 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Fluorouracil DMUM7HZ Approved Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3) affects the response to substance of Fluorouracil. [43]
------------------------------------------------------------------------------------
This DOT Affected the Regulation of Drug Effects of 3 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
2-deoxyglucose DMIAHVU Approved Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3) increases the transport of 2-deoxyglucose. [44]
CERC-801 DM3SZ7P Phase 2 Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3) increases the transport of CERC-801. [44]
Dehydroascorbic acid DMKYQO4 Investigative Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3) affects the transport of Dehydroascorbic acid. [45]
------------------------------------------------------------------------------------
62 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [1]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [2]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [3]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [4]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [5]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [6]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [2]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [7]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [8]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [9]
Vorinostat DMWMPD4 Approved Vorinostat increases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [10]
Testosterone DM7HUNW Approved Testosterone increases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [9]
Triclosan DMZUR4N Approved Triclosan decreases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [11]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [12]
Methotrexate DM2TEOL Approved Methotrexate decreases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [13]
Panobinostat DM58WKG Approved Panobinostat increases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [10]
Demecolcine DMCZQGK Approved Demecolcine increases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [14]
Niclosamide DMJAGXQ Approved Niclosamide decreases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [15]
Cannabidiol DM0659E Approved Cannabidiol increases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [16]
Bortezomib DMNO38U Approved Bortezomib increases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [17]
Clozapine DMFC71L Approved Clozapine decreases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [18]
Gemcitabine DMSE3I7 Approved Gemcitabine increases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [19]
Zidovudine DM4KI7O Approved Zidovudine decreases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [20]
Fluoxetine DM3PD2C Approved Fluoxetine decreases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [18]
Sertraline DM0FB1J Approved Sertraline decreases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [18]
Ampicillin DMHWE7P Approved Ampicillin increases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [7]
Thioridazine DM35M8J Approved Thioridazine decreases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [18]
Imipramine DM2NUH3 Approved Imipramine decreases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [18]
Vandetanib DMRICNP Approved Vandetanib increases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [21]
Clomipramine DMINRKW Approved Clomipramine decreases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [18]
Citalopram DM2G9AE Approved Citalopram decreases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [22]
Loratadine DMF3AN7 Approved Loratadine decreases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [18]
Pentamidine DMHZJCG Approved Pentamidine decreases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [18]
Quinidine DMLPICK Approved Quinidine decreases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [18]
Flecainide DMSQDLE Approved Flecainide decreases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [18]
Perhexiline DMINO7Z Approved Perhexiline decreases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [18]
Doxepin DMPI98T Approved Doxepin decreases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [22]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [23]
Dihydrotestosterone DM3S8XC Phase 4 Dihydrotestosterone increases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [24]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [10]
Epigallocatechin gallate DMCGWBJ Phase 3 Epigallocatechin gallate increases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [25]
Chlorpromazine DMBGZI3 Phase 3 Trial Chlorpromazine decreases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [18]
Amiodarone DMUTEX3 Phase 2/3 Trial Amiodarone decreases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [18]
DNCB DMDTVYC Phase 2 DNCB decreases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [26]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [2]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [27]
Chlorcyclizine DM3L52Q Phase 1 Chlorcyclizine decreases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [18]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [28]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 increases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [29]
Eugenol DM7US1H Patented Eugenol increases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [30]
Torcetrapib DMDHYM7 Discontinued in Phase 2 Torcetrapib increases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [31]
SB-431542 DM0YOXQ Preclinical SB-431542 increases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [32]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [34]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [35]
Milchsaure DM462BT Investigative Milchsaure affects the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [36]
Sulforaphane DMQY3L0 Investigative Sulforaphane increases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [37]
Acetaldehyde DMJFKG4 Investigative Acetaldehyde decreases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [38]
Nickel chloride DMI12Y8 Investigative Nickel chloride increases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [39]
Resorcinol DMM37C0 Investigative Resorcinol increases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [40]
Tributylstannanyl DMHN7CB Investigative Tributylstannanyl decreases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [26]
PP-242 DM2348V Investigative PP-242 decreases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [41]
Apigenin DMI3491 Investigative Apigenin decreases the expression of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [42]
------------------------------------------------------------------------------------
⏷ Show the Full List of 62 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3). [33]
------------------------------------------------------------------------------------

References

1 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
2 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
3 Retinoic acid represses a cassette of candidate pluripotency chromosome 12p genes during induced loss of human embryonal carcinoma tumorigenicity. Biochim Biophys Acta. 2005 Oct 15;1731(1):48-56. doi: 10.1016/j.bbaexp.2005.08.006. Epub 2005 Sep 1.
4 Determination of phospholipidosis potential based on gene expression analysis in HepG2 cells. Toxicol Sci. 2007 Mar;96(1):101-14.
5 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
6 Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
7 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
8 Chronic occupational exposure to arsenic induces carcinogenic gene signaling networks and neoplastic transformation in human lung epithelial cells. Toxicol Appl Pharmacol. 2012 Jun 1;261(2):204-16.
9 Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
10 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
11 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
12 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
13 Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
14 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
15 Growth inhibition of ovarian tumor-initiating cells by niclosamide. Mol Cancer Ther. 2012 Aug;11(8):1703-12.
16 Cannabidiol induces antioxidant pathways in keratinocytes by targeting BACH1. Redox Biol. 2020 Jan;28:101321. doi: 10.1016/j.redox.2019.101321. Epub 2019 Sep 5.
17 The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
18 A toxicogenomic approach to drug-induced phospholipidosis: analysis of its induction mechanism and establishment of a novel in vitro screening system. Toxicol Sci. 2005 Feb;83(2):282-92.
19 Gene expression profiling of breast cancer cells in response to gemcitabine: NF-kappaB pathway activation as a potential mechanism of resistance. Breast Cancer Res Treat. 2007 Apr;102(2):157-72.
20 Differential gene expression in human hepatocyte cell lines exposed to the antiretroviral agent zidovudine. Arch Toxicol. 2014 Mar;88(3):609-23. doi: 10.1007/s00204-013-1169-3. Epub 2013 Nov 30.
21 ZD6474 inhibits tumor growth and intraperitoneal dissemination in a highly metastatic orthotopic gastric cancer model. Int J Cancer. 2006 Jan 15;118(2):483-9. doi: 10.1002/ijc.21340.
22 In vitro detection of drug-induced phospholipidosis using gene expression and fluorescent phospholipid based methodologies. Toxicol Sci. 2007 Sep;99(1):162-73.
23 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
24 LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
25 Epigallocatechin-3-gallate downregulates PDHA1 interfering the metabolic pathways in human herpesvirus 8 harboring primary effusion lymphoma cells. Toxicol In Vitro. 2020 Jun;65:104753. doi: 10.1016/j.tiv.2019.104753. Epub 2019 Dec 17.
26 THP-1 monocytes but not macrophages as a potential alternative for CD34+ dendritic cells to identify chemical skin sensitizers. Toxicol Appl Pharmacol. 2009 Apr 15;236(2):221-30.
27 Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
28 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
29 Dose-dependent effects of caffeine in human Sertoli cells metabolism and oxidative profile: relevance for male fertility. Toxicology. 2015 Feb 3;328:12-20. doi: 10.1016/j.tox.2014.12.003. Epub 2014 Dec 5.
30 Microarray analyses in dendritic cells reveal potential biomarkers for chemical-induced skin sensitization. Mol Immunol. 2007 May;44(12):3222-33.
31 Clarifying off-target effects for torcetrapib using network pharmacology and reverse docking approach. BMC Syst Biol. 2012 Dec 10;6:152.
32 Activin/nodal signaling switches the terminal fate of human embryonic stem cell-derived trophoblasts. J Biol Chem. 2015 Apr 3;290(14):8834-48.
33 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
34 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
35 Cystathionine metabolic enzymes play a role in the inflammation resolution of human keratinocytes in response to sub-cytotoxic formaldehyde exposure. Toxicol Appl Pharmacol. 2016 Nov 1;310:185-194.
36 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
37 Sulforaphane-induced apoptosis in human leukemia HL-60 cells through extrinsic and intrinsic signal pathways and altering associated genes expression assayed by cDNA microarray. Environ Toxicol. 2017 Jan;32(1):311-328.
38 Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
39 The contact allergen nickel triggers a unique inflammatory and proangiogenic gene expression pattern via activation of NF-kappaB and hypoxia-inducible factor-1alpha. J Immunol. 2007 Mar 1;178(5):3198-207.
40 A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
41 Marine biogenics in sea spray aerosols interact with the mTOR signaling pathway. Sci Rep. 2019 Jan 24;9(1):675.
42 The effect of Apigenin on glycometabolism and cell death in an anaplastic thyroid cancer cell line. Toxicol Appl Pharmacol. 2023 Sep 15;475:116626. doi: 10.1016/j.taap.2023.116626. Epub 2023 Jul 10.
43 Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.
44 Kinetic analysis of the liver-type (GLUT2) and brain-type (GLUT3) glucose transporters in Xenopus oocytes: substrate specificities and effects of transport inhibitors. Biochem J. 1993 Mar 15;290 ( Pt 3)(Pt 3):701-6. doi: 10.1042/bj2900701.
45 6-Bromo-6-deoxy-L-ascorbic acid: an ascorbate analog specific for Na+-dependent vitamin C transporter but not glucose transporter pathways. J Biol Chem. 2005 Feb 18;280(7):5211-20. doi: 10.1074/jbc.M412925200. Epub 2004 Dec 6.