Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT2JHDO4)

• DOT Name: Ras association domain-containing protein 2 (RASSF2)
• Gene Name: RASSF2
• Related Disease:
  Adenocarcinoma
  Ovarian neoplasm
  Squamous cell carcinoma
  Advanced cancer
  Carcinoma of esophagus
  Cervical cancer
  Cervical carcinoma
  Childhood acute lymphoblastic leukemia
  Colorectal adenoma
  Colorectal carcinoma
  Colorectal neoplasm
  Endometriosis
  Esophageal cancer
  Esophageal squamous cell carcinoma
  Ewing sarcoma
  Gastric cancer
  Gastric neoplasm
  Goiter
  Head and neck cancer
  Head and neck carcinoma
  Lung cancer
  Lung carcinoma
  Lung neoplasm
  Neoplasm
  Neoplasm of esophagus
  Non-small-cell lung cancer
  Pancreatic cancer
  Penile cancer
  Prostate neoplasm
  Stomach cancer
  Systemic lupus erythematosus
  Thyroid cancer
  Thyroid gland carcinoma
  Thyroid tumor
  Laryngeal squamous cell carcinoma
  Type-1/2 diabetes
  Breast neoplasm
  Digestive system neoplasm
  Melanoma
• UniProt ID: RASF2_HUMAN
• Pfam ID: PF16517 ; PF00788
• Sequence:
  MDYSHQTSLVPCGQDKYISKNELLLHLKTYNLYYEGQNLQLRHREEEDEFIVEGLLNISW
  GLRRPIRLQMQDDNERIRPPPSSSSWHSGCNLGAQGTTLKPLTVPKVQISEVDAPPEGDQ
  MPSSTDSRGLKPLQEDTPQLMRTRSDVGVRRRGNVRTPSDQRRIRRHRFSINGHFYNHKT
  SVFTPAYGSVTNVRINSTMTTPQVLKLLLNKFKIENSAEEFALYVVHTSGEKQKLKATDY
  PLIARILQGPCEQISKVFLMEKDQVEEVTYDVAQYIKFEMPVLKSFIQKLQEEEDREVKK
  LMRKYTVLRLMIRQRLEEIAETPATI
• Function: Potential tumor suppressor. Acts as a KRAS-specific effector protein. May promote apoptosis and cell cycle arrest. Stabilizes STK3/MST2 by protecting it from proteasomal degradation.
• Tissue Specificity: Widely expressed with highest levels in brain, placenta, peripheral blood and lung. Frequently down-regulated in lung tumor cell lines.
• KEGG Pathway: Hippo sig.ling pathway - multiple species (hsa04392)

Molecular Interaction Atlas (MIA) of This DOT

39 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adenocarcinoma	DIS3IHTY	Definitive	Posttranslational Modification	[1]
Ovarian neoplasm	DISEAFTY	Definitive	Genetic Variation	[2]
Squamous cell carcinoma	DISQVIFL	Definitive	Biomarker	[1]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[3]
Carcinoma of esophagus	DISS6G4D	Strong	Altered Expression	[4]
Cervical cancer	DISFSHPF	Strong	Biomarker	[5]
Cervical carcinoma	DIST4S00	Strong	Biomarker	[5]
Childhood acute lymphoblastic leukemia	DISJ5D6U	Strong	Genetic Variation	[6]
Colorectal adenoma	DISTSVHM	Strong	Posttranslational Modification	[7]
Colorectal carcinoma	DIS5PYL0	Strong	Posttranslational Modification	[8]
Colorectal neoplasm	DISR1UCN	Strong	Genetic Variation	[9]
Endometriosis	DISX1AG8	Strong	Genetic Variation	[10]
Esophageal cancer	DISGB2VN	Strong	Altered Expression	[4]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Altered Expression	[4]
Ewing sarcoma	DISQYLV3	Strong	Posttranslational Modification	[11]
Gastric cancer	DISXGOUK	Strong	Posttranslational Modification	[12]
Gastric neoplasm	DISOKN4Y	Strong	Posttranslational Modification	[12]
Goiter	DISLCGI6	Strong	Posttranslational Modification	[13]
Head and neck cancer	DISBPSQZ	Strong	Biomarker	[14]
Head and neck carcinoma	DISOU1DS	Strong	Biomarker	[14]
Lung cancer	DISCM4YA	Strong	Biomarker	[5]
Lung carcinoma	DISTR26C	Strong	Biomarker	[5]
Lung neoplasm	DISVARNB	Strong	Posttranslational Modification	[15]
Neoplasm	DISZKGEW	Strong	Biomarker	[16]
Neoplasm of esophagus	DISOLKAQ	Strong	Altered Expression	[4]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Posttranslational Modification	[2]
Pancreatic cancer	DISJC981	Strong	Altered Expression	[17]
Penile cancer	DISGVGNQ	Strong	Posttranslational Modification	[18]
Prostate neoplasm	DISHDKGQ	Strong	Altered Expression	[19]
Stomach cancer	DISKIJSX	Strong	Posttranslational Modification	[12]
Systemic lupus erythematosus	DISI1SZ7	Strong	Genetic Variation	[20]
Thyroid cancer	DIS3VLDH	Strong	Biomarker	[13]
Thyroid gland carcinoma	DISMNGZ0	Strong	Biomarker	[13]
Thyroid tumor	DISLVKMD	Strong	Biomarker	[13]
Laryngeal squamous cell carcinoma	DIS9UUVF	moderate	Altered Expression	[21]
Type-1/2 diabetes	DISIUHAP	Disputed	Biomarker	[22]
Breast neoplasm	DISNGJLM	Limited	Biomarker	[23]
Digestive system neoplasm	DISPOJCT	Limited	Posttranslational Modification	[24]
Melanoma	DIS1RRCY	Limited	Altered Expression	[25]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Ras association domain-containing protein 2 (RASSF2).	[26]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Ras association domain-containing protein 2 (RASSF2).	[43]

19 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Ras association domain-containing protein 2 (RASSF2).	[27]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Ras association domain-containing protein 2 (RASSF2).	[28]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Ras association domain-containing protein 2 (RASSF2).	[29]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Ras association domain-containing protein 2 (RASSF2).	[30]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Ras association domain-containing protein 2 (RASSF2).	[31]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Ras association domain-containing protein 2 (RASSF2).	[32]
Isotretinoin	DM4QTBN	Approved	Isotretinoin increases the expression of Ras association domain-containing protein 2 (RASSF2).	[33]
Cytarabine	DMZD5QR	Approved	Cytarabine increases the expression of Ras association domain-containing protein 2 (RASSF2).	[34]
Dasatinib	DMJV2EK	Approved	Dasatinib increases the expression of Ras association domain-containing protein 2 (RASSF2).	[35]
Indomethacin	DMSC4A7	Approved	Indomethacin increases the expression of Ras association domain-containing protein 2 (RASSF2).	[36]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Ras association domain-containing protein 2 (RASSF2).	[37]
Curcumin	DMQPH29	Phase 3	Curcumin increases the expression of Ras association domain-containing protein 2 (RASSF2).	[38]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the mutagenesis of Ras association domain-containing protein 2 (RASSF2).	[39]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Ras association domain-containing protein 2 (RASSF2).	[40]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Ras association domain-containing protein 2 (RASSF2).	[41]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Ras association domain-containing protein 2 (RASSF2).	[42]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Ras association domain-containing protein 2 (RASSF2).	[44]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Ras association domain-containing protein 2 (RASSF2).	[45]
Phencyclidine	DMQBEYX	Investigative	Phencyclidine increases the expression of Ras association domain-containing protein 2 (RASSF2).	[46]

References

• [1] Differential role of gene hypermethylation in adenocarcinomas, squamous cell carcinomas and cervical intraepithelial lesions of the uterine cervix.Pathol Int. 2015 Sep;65(9):476-85. doi: 10.1111/pin.12332. Epub 2015 Jul 27.
• [2] Epigenetic regulation of the ras effector/tumour suppressor RASSF2 in breast and lung cancer.Oncogene. 2008 Mar 13;27(12):1805-11. doi: 10.1038/sj.onc.1210805. Epub 2007 Sep 24.
• [3] Niacin deficiency modulates genes involved in cancer: Are smokers at higher risk?.J Cell Biochem. 2019 Jan;120(1):232-242. doi: 10.1002/jcb.27324. Epub 2018 Sep 1.
• [4] Aberrant hypermethylation of RASSF2 in tumors and peripheral blood DNA as a biomarker for malignant progression and poor prognosis of esophageal squamous cell carcinoma.Clin Exp Metastasis. 2016 Jan;33(1):73-85. doi: 10.1007/s10585-015-9759-5.
• [5] RASSF2 hypermethylation is present and related to shorter survival in squamous cervical cancer.Mod Pathol. 2013 Aug;26(8):1111-22. doi: 10.1038/modpathol.2013.32. Epub 2013 Mar 29.
• [6] A childhood acute lymphoblastic leukemia genome-wide association study identifies novel sex-specific risk variants.Medicine (Baltimore). 2016 Nov;95(46):e5300. doi: 10.1097/MD.0000000000005300.
• [7] Genetic and epigenetic alterations of Ras signalling pathway in colorectal neoplasia: analysis based on tumour clinicopathological features.Br J Cancer. 2007 Nov 19;97(10):1425-31. doi: 10.1038/sj.bjc.6604014. Epub 2007 Oct 9.
• [8] Colorectal cancer and RASSF family--a special emphasis on RASSF1A.Int J Cancer. 2013 Jan 15;132(2):251-8. doi: 10.1002/ijc.27696. Epub 2012 Jul 14.
• [9] Correlation between hypermethylation of the RASSF2A promoter and K-ras/BRAF mutations in microsatellite-stable colorectal cancers.Int J Cancer. 2007 Jan 1;120(1):7-12. doi: 10.1002/ijc.22276.
• [10] Identification of differentially methylated genes in the malignant transformation of ovarian endometriosis.J Ovarian Res. 2014 Jul 10;7:73. doi: 10.1186/1757-2215-7-73.
• [11] Functional epigenetic approach identifies frequently methylated genes in Ewing sarcoma.Epigenetics. 2013 Nov;8(11):1198-204. doi: 10.4161/epi.26266. Epub 2013 Sep 4.
• [12] RASSF2, a potential tumour suppressor, is silenced by CpG island hypermethylation in gastric cancer.Br J Cancer. 2005 Dec 12;93(12):1395-9. doi: 10.1038/sj.bjc.6602854.
• [13] Frequent epigenetic inactivation of RASSF2 in thyroid cancer and functional consequences.Mol Cancer. 2010 Sep 29;9:264. doi: 10.1186/1476-4598-9-264.
• [14] Cancer-associated fibroblasts promote cancer cell growth through a miR-7-RASSF2-PAR-4 axis in the tumor microenvironment.Oncotarget. 2017 Jan 3;8(1):1290-1303. doi: 10.18632/oncotarget.13609.
• [15] Epigenetic inactivation of the RAS-effector gene RASSF2 in lung cancers.Int J Oncol. 2007 Jul;31(1):169-73.
• [16] The microRNA-200 family acts as an oncogene in colorectal cancer by inhibiting the tumor suppressor RASSF2.Oncol Lett. 2019 Oct;18(4):3994-4007. doi: 10.3892/ol.2019.10753. Epub 2019 Aug 16.
• [17] Aberrant methylation of RASSF2A in human pancreatic ductal adenocarcinoma and its relation to clinicopathologic features.Pancreas. 2012 Mar;41(2):206-11. doi: 10.1097/MPA.0b013e318223d1a5.
• [18] Differential gene hypermethylation in genital lichen sclerosus and cancer: a comparative study.Histopathology. 2013 Nov;63(5):659-69. doi: 10.1111/his.12204. Epub 2013 Sep 2.
• [19] The Ras effector RASSF2 controls the PAR-4 tumor suppressor.Mol Cell Biol. 2010 Jun;30(11):2608-20. doi: 10.1128/MCB.00208-09. Epub 2010 Apr 5.
• [20] GWAS identifies novel SLE susceptibility genes and explains the association of the HLA region.Genes Immun. 2014 Sep;15(6):347-54. doi: 10.1038/gene.2014.23. Epub 2014 May 29.
• [21] CircRASSF2 promotes laryngeal squamous cell carcinoma progression by regulating the miR-302b-3p/IGF-1R axis.Clin Sci (Lond). 2019 May 9;133(9):1053-1066. doi: 10.1042/CS20190110. Print 2019 May 15.
• [22] Gene Expression Meta-Analysis of Seven Candidate Gene Sets for Diabetes Traits Following a GWAS Pathway Study.Front Genet. 2018 Feb 16;9:52. doi: 10.3389/fgene.2018.00052. eCollection 2018.
• [23] Differential involvement of RASSF2 hypermethylation in breast cancer subtypes and their prognosis.Oncotarget. 2015 Sep 15;6(27):23944-58. doi: 10.18632/oncotarget.4062.
• [24] Analysis of fecal DNA methylation to detect gastrointestinal neoplasia.J Natl Cancer Inst. 2009 Sep 16;101(18):1244-58. doi: 10.1093/jnci/djp265. Epub 2009 Aug 21.
• [25] RASSF10 promoter hypermethylation is frequent in malignant melanoma of the skin but uncommon in nevus cell nevi.J Invest Dermatol. 2012 Mar;132(3 Pt 1):687-94. doi: 10.1038/jid.2011.380. Epub 2011 Nov 24.
• [26] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [27] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [28] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [29] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [30] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [31] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [32] Inactivation of RASSF2A by promoter methylation correlates with lymph node metastasis in nasopharyngeal carcinoma. Int J Cancer. 2007 Jan 1;120(1):32-8. doi: 10.1002/ijc.22185.
• [33] Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
• [34] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [35] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [36] Evaluation of developmental toxicity using undifferentiated human embryonic stem cells. J Appl Toxicol. 2015 Feb;35(2):205-18.
• [37] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [38] Gene-expression profiling during curcumin-induced apoptosis reveals downregulation of CXCR4. Exp Hematol. 2007 Jan;35(1):84-95.
• [39] Exome-wide mutation profile in benzo[a]pyrene-derived post-stasis and immortal human mammary epithelial cells. Mutat Res Genet Toxicol Environ Mutagen. 2014 Dec;775-776:48-54. doi: 10.1016/j.mrgentox.2014.10.011. Epub 2014 Nov 4.
• [40] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [41] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [42] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [43] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [44] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [45] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [46] Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.