Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT3E95KB)

DOT Name	Baculoviral IAP repeat-containing protein 3 (BIRC3)
Synonyms	EC 2.3.2.27; Apoptosis inhibitor 2; API2; Cellular inhibitor of apoptosis 2; C-IAP2; IAP homolog C; Inhibitor of apoptosis protein 1; hIAP-1; hIAP1; RING finger protein 49; RING-type E3 ubiquitin transferase BIRC3; TNFR2-TRAF-signaling complex protein 1
Gene Name	BIRC3
UniProt ID	BIRC3_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	2UVL; 3EB5; 3EB6; 3M0A; 3M0D; 7NK0
EC Number	2.3.2.27
Pfam ID	PF00653 ; PF21290 ; PF00619 ; PF13920
Sequence	MNIVENSIFLSNLMKSANTFELKYDLSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGV NDKVKCFCCGLMLDNWKRGDSPTEKHKKLYPSCRFVQSLNSVNNLEATSQPTFPSSVTNS THSLLPGTENSGYFRGSYSNSPSNPVNSRANQDFSALMRSSYHCAMNNENARLLTFQTWP LTFLSPTDLAKAGFYYIGPGDRVACFACGGKLSNWEPKDNAMSEHLRHFPKCPFIENQLQ DTSRYTVSNLSMQTHAARFKTFFNWPSSVLVNPEQLASAGFYYVGNSDDVKCFCCDGGLR CWESGDDPWVQHAKWFPRCEYLIRIKGQEFIRQVQASYPHLLEQLLSTSDSPGDENAESS IIHFEPGEDHSEDAIMMNTPVINAAVEMGFSRSLVKQTVQRKILATGENYRLVNDLVLDL LNAEDEIREEERERATEEKESNDLLLIRKNRMALFQHLTCVIPILDSLLTAGIINEQEHD VIKQKTQTSLQARELIDTILVKGNIAATVFRNSLQEAEAVLYEHLFVQQDIKYIPTEDVS DLPVEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRSTIKGTVR TFLS
Function	Multi-functional protein which regulates not only caspases and apoptosis, but also modulates inflammatory signaling and immunity, mitogenic kinase signaling and cell proliferation, as well as cell invasion and metastasis. Acts as an E3 ubiquitin-protein ligase regulating NF-kappa-B signaling and regulates both canonical and non-canonical NF-kappa-B signaling by acting in opposite directions: acts as a positive regulator of the canonical pathway and suppresses constitutive activation of non-canonical NF-kappa-B signaling. The target proteins for its E3 ubiquitin-protein ligase activity include: RIPK1, RIPK2, RIPK3, RIPK4, CASP3, CASP7, CASP8, IKBKE, TRAF1, and BCL10. Acts as an important regulator of innate immune signaling via regulation of Toll-like receptors (TLRs), Nodlike receptors (NLRs) and RIG-I like receptors (RLRs), collectively referred to as pattern recognition receptors (PRRs). Protects cells from spontaneous formation of the ripoptosome, a large multi-protein complex that has the capability to kill cancer cells in a caspase-dependent and caspase-independent manner. Suppresses ripoptosome formation by ubiquitinating RIPK1 and CASP8.
Tissue Specificity	Highly expressed in fetal lung, and kidney. In the adult, expression is mainly seen in lymphoid tissues, including spleen, thymus and peripheral blood lymphocytes.
KEGG Pathway	Platinum drug resistance (hsa01524 ) NF-kappa B sig.ling pathway (hsa04064 ) Ubiquitin mediated proteolysis (hsa04120 ) Apoptosis (hsa04210 ) Apoptosis - multiple species (hsa04215 ) Necroptosis (hsa04217 ) Hippo sig.ling pathway (hsa04390 ) Focal adhesion (hsa04510 ) NOD-like receptor sig.ling pathway (hsa04621 ) TNF sig.ling pathway (hsa04668 ) Salmonella infection (hsa05132 ) Toxoplasmosis (hsa05145 ) Herpes simplex virus 1 infection (hsa05168 ) Pathways in cancer (hsa05200 ) Transcriptio.l misregulation in cancer (hsa05202 ) Small cell lung cancer (hsa05222 )
Reactome Pathway	TICAM1, RIP1-mediated IKK complex recruitment (R-HSA-168927 ) RIPK1-mediated regulated necrosis (R-HSA-5213460 ) TNFR1-induced proapoptotic signaling (R-HSA-5357786 ) Regulation of TNFR1 signaling (R-HSA-5357905 ) TNFR1-induced NF-kappa-B signaling pathway (R-HSA-5357956 ) TNFR2 non-canonical NF-kB pathway (R-HSA-5668541 ) Regulation of necroptotic cell death (R-HSA-5675482 ) TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway (R-HSA-5676594 ) Ub-specific processing proteases (R-HSA-5689880 ) IKK complex recruitment mediated by RIP1 (R-HSA-937041 ) NOD1/2 Signaling Pathway (R-HSA-168638 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Vinblastine	DM5TVS3	Approved	Baculoviral IAP repeat-containing protein 3 (BIRC3) affects the response to substance of Vinblastine.	[73]
Staurosporine	DM0E9BR	Investigative	Baculoviral IAP repeat-containing protein 3 (BIRC3) decreases the response to substance of Staurosporine.	[74]
------------------------------------------------------------------------------------

80 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[5]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[6]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[2]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[7]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[8]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[9]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[10]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[11]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[12]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[13]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil increases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[14]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[16]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[17]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[18]
Bortezomib	DMNO38U	Approved	Bortezomib increases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[19]
Hydroquinone	DM6AVR4	Approved	Hydroquinone decreases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[20]
Etoposide	DMNH3PG	Approved	Etoposide decreases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[21]
Paclitaxel	DMLB81S	Approved	Paclitaxel decreases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[22]
Indomethacin	DMSC4A7	Approved	Indomethacin decreases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[23]
Menthol	DMG2KW7	Approved	Menthol decreases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[24]
Gemcitabine	DMSE3I7	Approved	Gemcitabine affects the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[25]
Obeticholic acid	DM3Q1SM	Approved	Obeticholic acid decreases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[26]
Fenofibrate	DMFKXDY	Approved	Fenofibrate decreases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[27]
Cyclophosphamide	DM4O2Z7	Approved	Cyclophosphamide decreases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[28]
Pioglitazone	DMKJ485	Approved	Pioglitazone decreases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[29]
Lindane	DMB8CNL	Approved	Lindane increases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[28]
Sorafenib	DMS8IFC	Approved	Sorafenib decreases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[30]
Dinoprostone	DMTYOPD	Approved	Dinoprostone increases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[31]
Nitric Oxide	DM1RBYG	Approved	Nitric Oxide decreases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[32]
Adenosine	DMM2NSK	Approved	Adenosine decreases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[33]
Trovafloxacin	DM6AN32	Approved	Trovafloxacin decreases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[34]
Ibrutinib	DMHZCPO	Approved	Ibrutinib decreases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[35]
Bendamustine hydrochloride	DMFH15Z	Approved	Bendamustine hydrochloride decreases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[36]
Aprepitant	DM053KT	Approved	Aprepitant decreases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[37]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[1]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[38]
Curcumin	DMQPH29	Phase 3	Curcumin decreases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[39]
HMPL-004	DM29XGY	Phase 3	HMPL-004 increases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[40]
Bardoxolone methyl	DMODA2X	Phase 3	Bardoxolone methyl increases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[40]
Triptolide	DMCMDVR	Phase 3	Triptolide decreases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[41]
Buparlisib	DM1WEHC	Phase 3	Buparlisib decreases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[42]
Peretinoin	DMESAZK	Phase 3	Peretinoin decreases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[43]
IB-MECA	DM9G5XD	Phase 3	IB-MECA decreases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[44]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate increases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[45]
Flavopiridol	DMKSUOI	Phase 2	Flavopiridol decreases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[46]
Bryostatin-1	DM1JOXY	Phase 2	Bryostatin-1 increases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[45]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[28]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[47]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[48]
LY294002	DMY1AFS	Phase 1	LY294002 decreases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[49]
PF-3758309	DM36PKZ	Phase 1	PF-3758309 decreases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[50]
VS-5584	DMMO3G5	Phase 1	VS-5584 decreases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[51]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[52]
MG-132	DMKA2YS	Preclinical	MG-132 increases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[19]
SC-236	DMO1URE	Terminated	SC-236 decreases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[31]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[53]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[54]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[55]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[40]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[56]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A decreases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[28]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate decreases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[57]
Paraquat	DMR8O3X	Investigative	Paraquat decreases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[58]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[59]
Phencyclidine	DMQBEYX	Investigative	Phencyclidine increases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[60]
cinnamaldehyde	DMZDUXG	Investigative	cinnamaldehyde decreases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[61]
acrolein	DMAMCSR	Investigative	acrolein increases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[62]
Tributylstannanyl	DMHN7CB	Investigative	Tributylstannanyl decreases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[63]
Microcystin-LR	DMTMLRN	Investigative	Microcystin-LR increases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[64]
BRN-3548355	DM4KXT0	Investigative	BRN-3548355 increases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[65]
Linalool	DMGZQ5P	Investigative	Linalool increases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[66]
15-deoxy-Delta(12, 14)-prostaglandin J(2)	DM8VUX3	Investigative	15-deoxy-Delta(12, 14)-prostaglandin J(2) decreases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[68]
Morin	DM2OGZ5	Investigative	Morin decreases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[69]
Beta-D-Glucose	DM5IHYP	Investigative	Beta-D-Glucose decreases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[70]
BAY11-7082	DMQNOFA	Investigative	BAY11-7082 decreases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[71]
Caffeic acid phenethyl ester	DMRJKIV	Investigative	Caffeic acid phenethyl ester decreases the expression of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[72]
------------------------------------------------------------------------------------


⏷ Show the Full List of 80 Drug(s)

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the methylation of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[15]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Apigenin	DMI3491	Investigative	Apigenin increases the cleavage of Baculoviral IAP repeat-containing protein 3 (BIRC3).	[67]
------------------------------------------------------------------------------------

References

1	Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
2	Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
3	Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
4	Nuclear factor-kappaB induced by doxorubicin is deficient in phosphorylation and acetylation and represses nuclear factor-kappaB-dependent transcription in cancer cells. Cancer Res. 2005 May 15;65(10):4273-81. doi: 10.1158/0008-5472.CAN-04-3494.
5	Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6	Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
7	Arsenic trioxide induces apoptosis in NB-4, an acute promyelocytic leukemia cell line, through up-regulation of p73 via suppression of nuclear factor kappa B-mediated inhibition of p73 transcription and prevention of NF-kappaB-mediated induction of XIAP, cIAP2, BCL-XL and survivin. Med Oncol. 2010 Sep;27(3):833-42. doi: 10.1007/s12032-009-9294-9. Epub 2009 Sep 10.
8	Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
9	A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
10	Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
11	Functional gene expression profile underlying methotrexate-induced senescence in human colon cancer cells. Tumour Biol. 2011 Oct;32(5):965-76.
12	Downmodulation of dimethyl transferase activity enhances tumor necrosis factor-related apoptosis-inducing ligand-induced apoptosis in prostate cancer cells. Int J Oncol. 2008 Aug;33(2):381-8.
13	Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
14	Transcriptional profiling of MCF7 breast cancer cells in response to 5-Fluorouracil: relationship with cell cycle changes and apoptosis, and identification of novel targets of p53. Int J Cancer. 2006 Sep 1;119(5):1164-75.
15	DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
16	Gene expression profile of human lymphoid CEM cells sensitive and resistant to glucocorticoid-evoked apoptosis. Genomics. 2003 Jun;81(6):543-55.
17	Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
18	Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
19	Long-term incubation with proteasome inhibitors (PIs) induces IB degradation via the lysosomal pathway in an IB kinase (IKK)-dependent and IKK-independent manner. J Biol Chem. 2013 Nov 8;288(45):32777-32786. doi: 10.1074/jbc.M113.480921. Epub 2013 Oct 1.
20	Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
21	Responses of genes involved in cell cycle control to diverse DNA damaging chemicals in human lung adenocarcinoma A549 cells. Cancer Cell Int. 2005 Aug 24;5:28. doi: 10.1186/1475-2867-5-28.
22	Resveratrol modifies the expression of apoptotic regulatory proteins and sensitizes non-Hodgkin's lymphoma and multiple myeloma cell lines to paclitaxel-induced apoptosis. Mol Cancer Ther. 2004 Jan;3(1):71-84.
23	Mechanisms of indomethacin-induced alterations in the choline phospholipid metabolism of breast cancer cells. Neoplasia. 2006 Sep;8(9):758-71.
24	Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
25	Gene expression profiling of breast cancer cells in response to gemcitabine: NF-kappaB pathway activation as a potential mechanism of resistance. Breast Cancer Res Treat. 2007 Apr;102(2):157-72.
26	Pharmacotoxicology of clinically-relevant concentrations of obeticholic acid in an organotypic human hepatocyte system. Toxicol In Vitro. 2017 Mar;39:93-103.
27	Fenofibrate induces effective apoptosis in mantle cell lymphoma by inhibiting the TNFalpha/NF-kappaB signaling axis. Leukemia. 2010 Aug;24(8):1476-86. doi: 10.1038/leu.2010.117. Epub 2010 Jun 3.
28	Transcriptome-based functional classifiers for direct immunotoxicity. Arch Toxicol. 2014 Mar;88(3):673-89.
29	Peroxisome proliferator activated receptor gamma (PPAR-gama) ligand pioglitazone regulated gene networks in term human primary trophoblast cells. Reprod Toxicol. 2018 Oct;81:99-107.
30	The multikinase inhibitor sorafenib induces caspase-dependent apoptosis in PC-3 prostate cancer cells. Asian J Androl. 2010 Jul;12(4):527-34. doi: 10.1038/aja.2010.21. Epub 2010 May 17.
31	Inhibition of apoptosis in normal and transformed intestinal epithelial cells by cAMP through induction of inhibitor of apoptosis protein (IAP)-2. Proc Natl Acad Sci U S A. 2003 Jul 22;100(15):8921-6. doi: 10.1073/pnas.1533221100. Epub 2003 Jul 1.
32	Apoptotic signaling pathways induced by nitric oxide in human lymphoblastoid cells expressing wild-type or mutant p53. Cancer Res. 2004 May 1;64(9):3022-9. doi: 10.1158/0008-5472.can-03-1880.
33	Adenosine-induced caspase-3 activation by tuning Bcl-XL/DIABLO/IAP expression in HuH-7 human hepatoma cells. Cell Biol Toxicol. 2010 Aug;26(4):319-30. doi: 10.1007/s10565-009-9145-7. Epub 2010 Jan 9.
34	The hepatotoxic fluoroquinolone trovafloxacin disturbs TNF- and LPS-induced p65 nuclear translocation in vivo and in vitro. Toxicol Appl Pharmacol. 2020 Mar 15;391:114915. doi: 10.1016/j.taap.2020.114915. Epub 2020 Feb 6.
35	Synergistic activity of BET protein antagonist-based combinations in mantle cell lymphoma cells sensitive or resistant to ibrutinib. Blood. 2015 Sep 24;126(13):1565-74.
36	Synergistic effects of chemotherapeutic drugs in lymphoma cells are associated with down-regulation of inhibitor of apoptosis proteins (IAPs), prostate-apoptosis-response-gene 4 (Par-4), death-associated protein (Daxx) and with enforced caspase activation. Biochem Pharmacol. 2003 Sep 1;66(5):711-24. doi: 10.1016/s0006-2952(03)00410-6.
37	Neurokinin-1 receptor (NK1R) inhibition sensitizes APL cells to anti-tumor effect of arsenic trioxide via restriction of NF-B axis: Shedding new light on resistance to Aprepitant. Int J Biochem Cell Biol. 2018 Oct;103:105-114. doi: 10.1016/j.biocel.2018.08.010. Epub 2018 Aug 23.
38	Bcl-2 overexpression attenuates resveratrol-induced apoptosis in U937 cells by inhibition of caspase-3 activity. Carcinogenesis. 2001 Oct;22(10):1633-9. doi: 10.1093/carcin/22.10.1633.
39	Curcumin suppresses growth and chemoresistance of human glioblastoma cells via AP-1 and NFkappaB transcription factors. J Neurochem. 2007 Jul;102(2):522-38. doi: 10.1111/j.1471-4159.2007.04633.x.
40	Mapping the dynamics of Nrf2 antioxidant and NFB inflammatory responses by soft electrophilic chemicals in human liver cells defines the transition from adaptive to adverse responses. Toxicol In Vitro. 2022 Oct;84:105419. doi: 10.1016/j.tiv.2022.105419. Epub 2022 Jun 17.
41	[Study of triptolide-induced apoptosis in MUTZ-1 cells and its allied mechanism]. Zhongguo Shi Yan Xue Ye Xue Za Zhi. 2005 Jun;13(3):434-9.
42	Inhibition of PI3K signaling pathway enhances the chemosensitivity of APL cells to ATO: Proposing novel therapeutic potential for BKM120. Eur J Pharmacol. 2018 Dec 15;841:10-18. doi: 10.1016/j.ejphar.2018.10.007. Epub 2018 Oct 11.
43	NIK-333 inhibits growth of human T-cell leukemia virus type I-infected T-cell lines and adult T-cell leukemia cells in association with blockade of nuclear factor-kappaB signal pathway. Mol Cancer Ther. 2006 Mar;5(3):704-12. doi: 10.1158/1535-7163.MCT-05-0434.
44	Induction of apoptosis by the adenosine derivative IB-MECA in parental or multidrug-resistant HL-60 leukemia cells: possible relationship to the effects on inhibitor of apoptosis protein levels. Chemotherapy. 2005 Aug;51(5):272-9. doi: 10.1159/000087255. Epub 2005 Jul 26.
45	Induction of cIAP-2 in human colon cancer cells through PKC delta/NF-kappa B. J Biol Chem. 2003 Dec 19;278(51):51091-9. doi: 10.1074/jbc.M306541200. Epub 2003 Oct 3.
46	Flavopiridol down-regulates antiapoptotic proteins and sensitizes human breast cancer cells to epothilone B-induced apoptosis. Cancer Res. 2003 Jan 1;63(1):93-9.
47	BET inhibition as a single or combined therapeutic approach in primary paediatric B-precursor acute lymphoblastic leukaemia. Blood Cancer J. 2013 Jul 19;3(7):e126. doi: 10.1038/bcj.2013.24.
48	Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
49	A new selective AKT pharmacological inhibitor reduces resistance to chemotherapeutic drugs, TRAIL, all-trans-retinoic acid, and ionizing radiation of human leukemia cells. Leukemia. 2003 Sep;17(9):1794-805. doi: 10.1038/sj.leu.2403044.
50	Inhibition of neuroblastoma proliferation by PF-3758309, a small-molecule inhibitor that targets p21-activated kinase 4. Oncol Rep. 2017 Nov;38(5):2705-2716. doi: 10.3892/or.2017.5989. Epub 2017 Sep 22.
51	VS-5584 as a PI3K/mTOR inhibitor enhances apoptotic effects of subtoxic dose arsenic trioxide via inhibition of NF-B activity in B cell precursor-acute lymphoblastic leukemia. Biomed Pharmacother. 2018 Jun;102:428-437. doi: 10.1016/j.biopha.2018.03.009. Epub 2018 Mar 23.
52	Critical role of endogenous Akt/IAPs and MEK1/ERK pathways in counteracting endoplasmic reticulum stress-induced cell death. J Biol Chem. 2004 Nov 19;279(47):49420-9. doi: 10.1074/jbc.M407700200. Epub 2004 Aug 31.
53	Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
54	From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
55	Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
56	Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
57	Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
58	Identification of genes associated with paraquat-induced toxicity in SH-SY5Y cells by PCR array focused on apoptotic pathways. J Toxicol Environ Health A. 2008;71(22):1457-67. doi: 10.1080/15287390802329364.
59	The contact allergen nickel triggers a unique inflammatory and proangiogenic gene expression pattern via activation of NF-kappaB and hypoxia-inducible factor-1alpha. J Immunol. 2007 Mar 1;178(5):3198-207.
60	Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.
61	Effects of vitamin E on the cinnamaldehyde-induced apoptotic mechanism in human PLC/PRF/5 cells. Clin Exp Pharmacol Physiol. 2004 Nov;31(11):770-6. doi: 10.1111/j.1440-1681.2004.04091.x.
62	Acrolein induces a cellular stress response and triggers mitochondrial apoptosis in A549 cells. Chem Biol Interact. 2009 Oct 7;181(2):154-67. doi: 10.1016/j.cbi.2009.07.001. Epub 2009 Jul 9.
63	Toxicogenomic analysis identifies the apoptotic pathway as the main cause of hepatotoxicity induced by tributyltin. Food Chem Toxicol. 2016 Nov;97:316-326. doi: 10.1016/j.fct.2016.09.027. Epub 2016 Sep 24.
64	Toxic effects of microcystin-LR on the HepG2 cell line under hypoxic and normoxic conditions. J Appl Toxicol. 2013 Oct;33(10):1180-6. doi: 10.1002/jat.2749. Epub 2012 Apr 27.
65	Haem oxygenase-1 plays a central role in NNK-mediated lung carcinogenesis. Eur Respir J. 2008 Oct;32(4):911-23. doi: 10.1183/09031936.00064508. Epub 2008 May 28.
66	Linalool preferentially induces robust apoptosis of a variety of leukemia cells via upregulating p53 and cyclin-dependent kinase inhibitors. Toxicology. 2010 Jan 31;268(1-2):19-24. doi: 10.1016/j.tox.2009.11.013. Epub 2009 Nov 14.
67	Apigenin drives the production of reactive oxygen species and initiates a mitochondrial mediated cell death pathway in prostate epithelial cells. Prostate. 2005 May 1;63(2):131-42. doi: 10.1002/pros.20167.
68	15-Deoxy-delta 12,14-prostaglandin J2 induces apoptosis in human malignant B cells: an effect associated with inhibition of NF-kappa B activity and down-regulation of antiapoptotic proteins. Blood. 2005 Feb 15;105(4):1750-8. doi: 10.1182/blood-2004-04-1360. Epub 2004 Oct 21.
69	Molecular mechanism of anti-cancerous potential of Morin extracted from mulberry in Hela cells. Food Chem Toxicol. 2018 Feb;112:466-475. doi: 10.1016/j.fct.2017.07.002. Epub 2017 Jul 6.
70	Neisseria gonorrhoeae delays the onset of apoptosis in polymorphonuclear leukocytes. Cell Microbiol. 2006 Nov;8(11):1780-90. doi: 10.1111/j.1462-5822.2006.00748.x. Epub 2006 Jun 27.
71	NF-kappaB is essential for the progression of KSHV- and EBV-infected lymphomas in vivo. Blood. 2006 Apr 15;107(8):3295-302. doi: 10.1182/blood-2005-07-2730. Epub 2005 Dec 27.
72	Caffeic acid phenethyl ester-induced PC-3 cell apoptosis is caspase-dependent and mediated through the loss of inhibitors of apoptosis proteins. BJU Int. 2004 Aug;94(3):402-6. doi: 10.1111/j.1464-410X.2004.04936.x.
73	Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.
74	Glucocorticoids inhibit cell death in ovarian cancer and up-regulate caspase inhibitor cIAP2. Clin Cancer Res. 2005 Sep 1;11(17):6325-32. doi: 10.1158/1078-0432.CCR-05-0182.