Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT4XINUJ)

DOT Name	T-cell surface glycoprotein CD1c (CD1C)
Synonyms	CD antigen CD1c
Gene Name	CD1C
Related Disease	Primary biliary cholangitis ( ) Tuberculosis ( ) Acute leukaemia ( ) Adrenoleukodystrophy ( ) Allergic rhinitis ( ) Autoimmune disease ( ) Crohn disease ( ) Familial Mediterranean fever ( ) Hepatitis C virus infection ( ) HIV infectious disease ( ) Hyperlipidemia ( ) Immunodeficiency ( ) Leukemia ( ) Malaria ( ) Nasal polyp ( ) Nephritis ( ) Psoriasis ( ) Rheumatoid arthritis ( ) Small lymphocytic lymphoma ( ) Squamous cell carcinoma ( ) Advanced cancer ( ) Chronic obstructive pulmonary disease ( ) Hashimoto thyroiditis ( ) Hepatocellular carcinoma ( ) Neoplasm ( ) Adult glioblastoma ( ) Glioblastoma multiforme ( ) Atopic dermatitis ( ) Granular corneal dystrophy type II ( ) Nasopharyngeal carcinoma ( ) Sickle-cell anaemia ( ) Thalassemia ( )
UniProt ID	CD1C_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	3OV6; 4ONO; 5C9J; 6C09; 6C15
Pfam ID	PF07654 ; PF16497
Sequence	MLFLQFLLLALLLPGGDNADASQEHVSFHVIQIFSFVNQSWARGQGSGWLDELQTHGWDS ESGTIIFLHNWSKGNFSNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQVKAGC ELHSGKSPEGFFQVAFNGLDLLSFQNTTWVPSPGCGSLAQSVCHLLNHQYEGVTETVYNL IRSTCPRFLLGLLDAGKMYVHRQVRPEAWLSSRPSLGSGQLLLVCHASGFYPKPVWVTWM RNEQEQLGTKHGDILPNADGTWYLQVILEVASEEPAGLSCRVRHSSLGGQDIILYWGHHF SMNWIALVVIVPLVILIVLVLWFKKHCSYQDIL
Function	Antigen-presenting protein that binds self and non-self lipid and glycolipid antigens and presents them to T-cell receptors on natural killer T-cells.
Tissue Specificity	Expressed on cortical thymocytes, on certain T-cell leukemias, and in various other tissues.
KEGG Pathway	Tight junction (hsa04530 ) Hematopoietic cell lineage (hsa04640 ) Amoebiasis (hsa05146 )
Reactome Pathway	Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell (R-HSA-198933 )

Molecular Interaction Atlas (MIA) of This DOT

32 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Primary biliary cholangitis	DIS43E0O	Definitive	Biomarker	[1]
Tuberculosis	DIS2YIMD	Definitive	Biomarker	[2]
Acute leukaemia	DISDQFDI	Strong	Biomarker	[3]
Adrenoleukodystrophy	DISTUD1F	Strong	Genetic Variation	[4]
Allergic rhinitis	DIS3U9HN	Strong	Biomarker	[5]
Autoimmune disease	DISORMTM	Strong	Biomarker	[6]
Crohn disease	DIS2C5Q8	Strong	Altered Expression	[7]
Familial Mediterranean fever	DISVP5WP	Strong	Biomarker	[8]
Hepatitis C virus infection	DISQ0M8R	Strong	Biomarker	[9]
HIV infectious disease	DISO97HC	Strong	Biomarker	[10]
Hyperlipidemia	DIS61J3S	Strong	Biomarker	[11]
Immunodeficiency	DIS093I0	Strong	Biomarker	[3]
Leukemia	DISNAKFL	Strong	Biomarker	[3]
Malaria	DISQ9Y50	Strong	Biomarker	[12]
Nasal polyp	DISLP3XE	Strong	Biomarker	[13]
Nephritis	DISQZQ70	Strong	Biomarker	[14]
Psoriasis	DIS59VMN	Strong	Biomarker	[15]
Rheumatoid arthritis	DISTSB4J	Strong	Altered Expression	[6]
Small lymphocytic lymphoma	DIS30POX	Strong	Altered Expression	[16]
Squamous cell carcinoma	DISQVIFL	Strong	Altered Expression	[17]
Advanced cancer	DISAT1Z9	moderate	Biomarker	[18]
Chronic obstructive pulmonary disease	DISQCIRF	moderate	Altered Expression	[19]
Hashimoto thyroiditis	DIS77CDF	moderate	Altered Expression	[20]
Hepatocellular carcinoma	DIS0J828	moderate	Biomarker	[21]
Neoplasm	DISZKGEW	moderate	Biomarker	[22]
Adult glioblastoma	DISVP4LU	Disputed	Biomarker	[23]
Glioblastoma multiforme	DISK8246	Disputed	Biomarker	[23]
Atopic dermatitis	DISTCP41	Limited	Biomarker	[24]
Granular corneal dystrophy type II	DISAEE20	Limited	Genetic Variation	[25]
Nasopharyngeal carcinoma	DISAOTQ0	Limited	Biomarker	[26]
Sickle-cell anaemia	DIS5YNZB	Limited	Altered Expression	[27]
Thalassemia	DIS76XZB	Limited	Altered Expression	[27]
------------------------------------------------------------------------------------


⏷ Show the Full List of 32 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Amphotericin B	DMTAJQE	Approved	Amphotericin B increases the expression of T-cell surface glycoprotein CD1c (CD1C).	[28]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of T-cell surface glycoprotein CD1c (CD1C).	[29]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of T-cell surface glycoprotein CD1c (CD1C).	[30]
------------------------------------------------------------------------------------

References

1	Significance of periductal Langerhans cells and biliary epithelial cell-derived macrophage inflammatory protein-3 in the pathogenesis of primary biliary cirrhosis.Liver Int. 2011 Feb;31(2):245-53. doi: 10.1111/j.1478-3231.2010.02367.x. Epub 2010 Nov 24.
2	MiR-381-3p Regulates the Antigen-Presenting Capability of Dendritic Cells and Represses Antituberculosis Cellular Immune Responses by Targeting CD1c.J Immunol. 2016 Jul 15;197(2):580-9. doi: 10.4049/jimmunol.1500481. Epub 2016 Jun 13.
3	A novel self-lipid antigen targets human T cells against CD1c(+) leukemias.J Exp Med. 2014 Jun 30;211(7):1363-77. doi: 10.1084/jem.20140410. Epub 2014 Jun 16.
4	CD1 gene polymorphisms and phenotypic variability in X-linked adrenoleukodystrophy.PLoS One. 2012;7(1):e29872. doi: 10.1371/journal.pone.0029872. Epub 2012 Jan 12.
5	A thymic stromal lymphopoietin-responsive dendritic cell subset mediates allergic responses in the upper airway mucosa.J Allergy Clin Immunol. 2014 Sep;134(3):613-621.e7. doi: 10.1016/j.jaci.2014.05.010. Epub 2014 Jun 21.
6	Association of Dendritic Cell Signatures With Autoimmune Inflammation Revealed by Single-Cell Profiling.Arthritis Rheumatol. 2019 May;71(5):817-828. doi: 10.1002/art.40793. Epub 2019 Apr 6.
7	Dendritic cells from Crohn's disease patients show aberrant STAT1 and STAT3 signaling.PLoS One. 2013 Aug 7;8(8):e70738. doi: 10.1371/journal.pone.0070738. eCollection 2013.
8	Folliculotropic Mycosis Fungoides with Skewed T-cell Receptor CDR3 Motif: Suggestive of Lipid-antigen Selection?.Acta Derm Venereol. 2017 Oct 2;97(9):1081-1086. doi: 10.2340/00015555-2722.
9	Myeloid dendritic cells of patients with chronic HCV infection induce proliferation of regulatory T lymphocytes.Gastroenterology. 2008 Dec;135(6):2119-27. doi: 10.1053/j.gastro.2008.07.082. Epub 2008 Aug 7.
10	IgG opsonization of HIV impedes provirus formation in and infection of dendritic cells and subsequent long-term transfer to T cells.J Immunol. 2007 Jun 15;178(12):7840-8. doi: 10.4049/jimmunol.178.12.7840.
11	CD1b-autoreactive T cells contribute to hyperlipidemia-induced skin inflammation in mice.J Clin Invest. 2017 Jun 1;127(6):2339-2352. doi: 10.1172/JCI92217. Epub 2017 May 2.
12	Functional Human CD141+ Dendritic Cells in Human Immune System Mice.J Infect Dis. 2020 Jan 2;221(2):201-213. doi: 10.1093/infdis/jiz432.
13	Elevated presence of myeloid dendritic cells in nasal polyps of patients with chronic rhinosinusitis.Clin Exp Allergy. 2015 Feb;45(2):384-93. doi: 10.1111/cea.12471.
14	Infiltrating dendritic cells contribute to local synthesis of C1q in murine and human lupus nephritis.Mol Immunol. 2010 Jul;47(11-12):2129-37. doi: 10.1016/j.molimm.2010.02.006. Epub 2010 Apr 24.
15	A molecular basis of human T cell receptor autoreactivity toward self-phospholipids.Sci Immunol. 2017 Oct 20;2(16):eaao1384. doi: 10.1126/sciimmunol.aao1384.
16	Expression profiling of B cell chronic lymphocytic leukemia suggests deficient CD1-mediated immunity, polarized cytokine response, altered adhesion and increased intracellular protein transport and processing of leukemic cells.Leukemia. 2002 Dec;16(12):2429-37. doi: 10.1038/sj.leu.2402711.
17	Toll-like receptors 7, 8, and 9 expression and function in primary human cervical cancer Langerhans cells: evidence of anergy.Int J Gynecol Cancer. 2013 Jan;23(1):184-92. doi: 10.1097/IGC.0b013e31827a2003.
18	A Subset of Human Autoreactive CD1c-Restricted T Cells Preferentially Expresses TRBV4-1(+) TCRs.J Immunol. 2018 Jan 15;200(2):500-511. doi: 10.4049/jimmunol.1700677. Epub 2017 Dec 13.
19	Impact of smoking on dendritic cell phenotypes in the airway lumen of patients with COPD.Respir Res. 2014 Apr 18;15(1):48. doi: 10.1186/1465-9921-15-48.
20	CD1a and CD1c activate intrathyroidal T cells during Graves' disease and Hashimoto's thyroiditis.J Immunol. 2005 Mar 15;174(6):3773-80. doi: 10.4049/jimmunol.174.6.3773.
21	The Expression of ILT4 in Myeloid Dendritic Cells in Patients with Hepatocellular Carcinoma.Immunol Invest. 2019 Oct;48(7):704-718. doi: 10.1080/08820139.2019.1571507. Epub 2019 May 2.
22	Expansion of a BDCA1+CD14+ Myeloid Cell Population in Melanoma Patients May Attenuate the Efficacy of Dendritic Cell Vaccines.Cancer Res. 2016 Aug 1;76(15):4332-46. doi: 10.1158/0008-5472.CAN-15-1695. Epub 2016 Jun 20.
23	Impaired circulating myeloid CD1c+ dendritic cell function in human glioblastoma is restored by p38 inhibition - implications for the next generation of DC vaccines.Oncoimmunology. 2019 Apr 13;8(7):1593803. doi: 10.1080/2162402X.2019.1593803. eCollection 2019.
24	CD1c+ Blood Dendritic Cells in Atopic Dermatitis are Premature and Can Produce Disease-specific Chemokines.Acta Derm Venereol. 2017 Mar 10;97(3):325-331. doi: 10.2340/00015555-2540.
25	Development of a DNA chip for the diagnosis of the most common corneal dystrophies caused by mutations in the betaigh3 gene.Br J Ophthalmol. 2007 Jun;91(6):722-7. doi: 10.1136/bjo.2006.111070. Epub 2007 Jan 10.
26	Dendritic cell subpopulations in nasopharyngeal cancer.Oncol Lett. 2019 Feb;17(2):2557-2561. doi: 10.3892/ol.2018.9835. Epub 2018 Dec 14.
27	Upregulation and atypical expression of the CD1 molecules on monocytes in sickle cell disease.Hum Immunol. 2004 Nov;65(11):1370-6. doi: 10.1016/j.humimm.2004.09.009.
28	Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
29	Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
30	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.