Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT52AU22)

DOT Name Diamine acetyltransferase 1 (SAT1)
Synonyms EC 2.3.1.57; Polyamine N-acetyltransferase 1; Putrescine acetyltransferase; Spermidine/spermine N(1)-acetyltransferase 1; SSAT; SSAT-1
Gene Name SAT1
UniProt ID
SAT1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2B3U; 2B3V; 2B4B; 2B4D; 2B58; 2B5G; 2F5I; 2FXF; 2G3T; 2JEV
EC Number
2.3.1.57
Pfam ID
PF00583
Sequence
MAKFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVP
KEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRC
RCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE
Function
Enzyme which catalyzes the acetylation of polyamines. Substrate specificity: norspermidine = spermidine >> spermine > N(1)-acetylspermine. This highly regulated enzyme allows a fine attenuation of the intracellular concentration of polyamines. Also involved in the regulation of polyamine transport out of cells. Also acts on 1,3-diaminopropane and 1,5-diaminopentane.
KEGG Pathway
Arginine and proline metabolism (hsa00330 )
Metabolic pathways (hsa01100 )
Ferroptosis (hsa04216 )
Reactome Pathway
Interconversion of polyamines (R-HSA-351200 )
BioCyc Pathway
MetaCyc:HS05339-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 2 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
DTI-015 DMXZRW0 Approved Diamine acetyltransferase 1 (SAT1) affects the response to substance of DTI-015. [43]
Mitomycin DMH0ZJE Approved Diamine acetyltransferase 1 (SAT1) affects the response to substance of Mitomycin. [44]
------------------------------------------------------------------------------------
57 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Diamine acetyltransferase 1 (SAT1). [1]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Diamine acetyltransferase 1 (SAT1). [2]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Diamine acetyltransferase 1 (SAT1). [3]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Diamine acetyltransferase 1 (SAT1). [4]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Diamine acetyltransferase 1 (SAT1). [5]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Diamine acetyltransferase 1 (SAT1). [6]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Diamine acetyltransferase 1 (SAT1). [7]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Diamine acetyltransferase 1 (SAT1). [8]
Quercetin DM3NC4M Approved Quercetin increases the expression of Diamine acetyltransferase 1 (SAT1). [9]
Temozolomide DMKECZD Approved Temozolomide increases the expression of Diamine acetyltransferase 1 (SAT1). [10]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of Diamine acetyltransferase 1 (SAT1). [11]
Vorinostat DMWMPD4 Approved Vorinostat increases the expression of Diamine acetyltransferase 1 (SAT1). [12]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Diamine acetyltransferase 1 (SAT1). [13]
Methotrexate DM2TEOL Approved Methotrexate increases the expression of Diamine acetyltransferase 1 (SAT1). [14]
Decitabine DMQL8XJ Approved Decitabine affects the expression of Diamine acetyltransferase 1 (SAT1). [15]
Selenium DM25CGV Approved Selenium decreases the expression of Diamine acetyltransferase 1 (SAT1). [16]
Phenobarbital DMXZOCG Approved Phenobarbital affects the expression of Diamine acetyltransferase 1 (SAT1). [17]
Fluorouracil DMUM7HZ Approved Fluorouracil increases the expression of Diamine acetyltransferase 1 (SAT1). [18]
Panobinostat DM58WKG Approved Panobinostat increases the expression of Diamine acetyltransferase 1 (SAT1). [12]
Folic acid DMEMBJC Approved Folic acid increases the expression of Diamine acetyltransferase 1 (SAT1). [19]
Demecolcine DMCZQGK Approved Demecolcine increases the expression of Diamine acetyltransferase 1 (SAT1). [20]
Diethylstilbestrol DMN3UXQ Approved Diethylstilbestrol decreases the expression of Diamine acetyltransferase 1 (SAT1). [21]
Aspirin DM672AH Approved Aspirin increases the expression of Diamine acetyltransferase 1 (SAT1). [22]
Irinotecan DMP6SC2 Approved Irinotecan increases the expression of Diamine acetyltransferase 1 (SAT1). [18]
Diclofenac DMPIHLS Approved Diclofenac affects the expression of Diamine acetyltransferase 1 (SAT1). [13]
Indomethacin DMSC4A7 Approved Indomethacin increases the expression of Diamine acetyltransferase 1 (SAT1). [22]
Gemcitabine DMSE3I7 Approved Gemcitabine increases the expression of Diamine acetyltransferase 1 (SAT1). [23]
Sulindac DM2QHZU Approved Sulindac increases the expression of Diamine acetyltransferase 1 (SAT1). [24]
Ibuprofen DM8VCBE Approved Ibuprofen increases the expression of Diamine acetyltransferase 1 (SAT1). [22]
Lucanthone DMZLBUO Approved Lucanthone increases the expression of Diamine acetyltransferase 1 (SAT1). [25]
Raltitrexed DMT9K8G Approved Raltitrexed increases the expression of Diamine acetyltransferase 1 (SAT1). [18]
Dihydrotestosterone DM3S8XC Phase 4 Dihydrotestosterone increases the expression of Diamine acetyltransferase 1 (SAT1). [26]
Resveratrol DM3RWXL Phase 3 Resveratrol decreases the expression of Diamine acetyltransferase 1 (SAT1). [21]
Tamibarotene DM3G74J Phase 3 Tamibarotene increases the expression of Diamine acetyltransferase 1 (SAT1). [3]
EXISULIND DMBY56U Phase 3 EXISULIND increases the expression of Diamine acetyltransferase 1 (SAT1). [24]
Genistein DM0JETC Phase 2/3 Genistein decreases the expression of Diamine acetyltransferase 1 (SAT1). [21]
Tocopherol DMBIJZ6 Phase 2 Tocopherol decreases the expression of Diamine acetyltransferase 1 (SAT1). [16]
Belinostat DM6OC53 Phase 2 Belinostat increases the expression of Diamine acetyltransferase 1 (SAT1). [27]
DNCB DMDTVYC Phase 2 DNCB increases the expression of Diamine acetyltransferase 1 (SAT1). [28]
PEITC DMOMN31 Phase 2 PEITC increases the expression of Diamine acetyltransferase 1 (SAT1). [29]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Diamine acetyltransferase 1 (SAT1). [30]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 increases the expression of Diamine acetyltransferase 1 (SAT1). [31]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide increases the expression of Diamine acetyltransferase 1 (SAT1). [32]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Diamine acetyltransferase 1 (SAT1). [33]
Eugenol DM7US1H Patented Eugenol increases the expression of Diamine acetyltransferase 1 (SAT1). [28]
THAPSIGARGIN DMDMQIE Preclinical THAPSIGARGIN increases the expression of Diamine acetyltransferase 1 (SAT1). [34]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Diamine acetyltransferase 1 (SAT1). [35]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Diamine acetyltransferase 1 (SAT1). [27]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of Diamine acetyltransferase 1 (SAT1). [20]
Milchsaure DM462BT Investigative Milchsaure increases the expression of Diamine acetyltransferase 1 (SAT1). [36]
Coumestrol DM40TBU Investigative Coumestrol decreases the expression of Diamine acetyltransferase 1 (SAT1). [8]
Sulforaphane DMQY3L0 Investigative Sulforaphane increases the expression of Diamine acetyltransferase 1 (SAT1). [37]
chloropicrin DMSGBQA Investigative chloropicrin affects the expression of Diamine acetyltransferase 1 (SAT1). [38]
Phencyclidine DMQBEYX Investigative Phencyclidine increases the expression of Diamine acetyltransferase 1 (SAT1). [39]
QUERCITRIN DM1DH96 Investigative QUERCITRIN decreases the expression of Diamine acetyltransferase 1 (SAT1). [40]
Distamycin A DMPVNDK Investigative Distamycin A increases the expression of Diamine acetyltransferase 1 (SAT1). [41]
METHOCTRAMINE DMH2CKX Investigative METHOCTRAMINE increases the activity of Diamine acetyltransferase 1 (SAT1). [42]
------------------------------------------------------------------------------------
⏷ Show the Full List of 57 Drug(s)

References

1 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
2 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
3 Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
4 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
5 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
6 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
7 The thioxotriazole copper(II) complex A0 induces endoplasmic reticulum stress and paraptotic death in human cancer cells. J Biol Chem. 2009 Sep 4;284(36):24306-19.
8 Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
9 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
10 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
11 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
12 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
13 Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
14 Methotrexate modulates folate phenotype and inflammatory profile in EA.hy 926 cells. Eur J Pharmacol. 2014 Jun 5;732:60-7.
15 Epigenetic silencing of novel tumor suppressors in malignant melanoma. Cancer Res. 2006 Dec 1;66(23):11187-93. doi: 10.1158/0008-5472.CAN-06-1274.
16 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
17 Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
18 5-Fluorouracil: identification of novel downstream mediators of tumour response. Anticancer Res. 2004 Mar-Apr;24(2A):417-23.
19 High folic acid increases cell turnover and lowers differentiation and iron content in human HT29 colon cancer cells. Br J Nutr. 2008 Apr;99(4):703-8.
20 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
21 Gene expression profiling in Ishikawa cells: a fingerprint for estrogen active compounds. Toxicol Appl Pharmacol. 2009 Apr 1;236(1):85-96.
22 Induction of spermidine/spermine N1-acetyltransferase (SSAT) by aspirin in Caco-2 colon cancer cells. Biochem J. 2006 Feb 15;394(Pt 1):317-24.
23 Gene expression profiling of breast cancer cells in response to gemcitabine: NF-kappaB pathway activation as a potential mechanism of resistance. Breast Cancer Res Treat. 2007 Apr;102(2):157-72.
24 Cyclooxygenase-independent induction of apoptosis by sulindac sulfone is mediated by polyamines in colon cancer. J Biol Chem. 2003 Nov 28;278(48):47762-75.
25 Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
26 LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
27 Gene expression-signature of belinostat in cell lines is specific for histone deacetylase inhibitor treatment, with a corresponding signature in xenografts. Anticancer Drugs. 2009 Sep;20(8):682-92.
28 Microarray analyses in dendritic cells reveal potential biomarkers for chemical-induced skin sensitization. Mol Immunol. 2007 May;44(12):3222-33.
29 Phenethyl isothiocyanate alters the gene expression and the levels of protein associated with cell cycle regulation in human glioblastoma GBM 8401 cells. Environ Toxicol. 2017 Jan;32(1):176-187.
30 Genome-wide transcriptional and functional analysis of human T lymphocytes treated with benzo[alpha]pyrene. Int J Mol Sci. 2018 Nov 17;19(11).
31 BET bromodomain inhibition as a therapeutic strategy to target c-Myc. Cell. 2011 Sep 16;146(6):904-17.
32 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
33 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
34 Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
35 Characterization of the Molecular Alterations Induced by the Prolonged Exposure of Normal Colon Mucosa and Colon Cancer Cells to Low-Dose Bisphenol A. Int J Mol Sci. 2022 Oct 1;23(19):11620. doi: 10.3390/ijms231911620.
36 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
37 Sulforaphane-induced apoptosis in human leukemia HL-60 cells through extrinsic and intrinsic signal pathways and altering associated genes expression assayed by cDNA microarray. Environ Toxicol. 2017 Jan;32(1):311-328.
38 Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
39 Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.
40 Molecular mechanisms of quercitrin-induced apoptosis in non-small cell lung cancer. Arch Med Res. 2014 Aug;45(6):445-54.
41 Distamycin A and derivatives as synergic drugs in cisplatin-sensitive and -resistant ovarian cancer cells. Amino Acids. 2012 Feb;42(2-3):641-53.
42 Cytotoxicity of methoctramine and methoctramine-related polyamines. Chem Biol Interact. 2009 Oct 30;181(3):409-16. doi: 10.1016/j.cbi.2009.06.015. Epub 2009 Jul 1.
43 Tumor necrosis factor-alpha-induced protein 3 as a putative regulator of nuclear factor-kappaB-mediated resistance to O6-alkylating agents in human glioblastomas. J Clin Oncol. 2006 Jan 10;24(2):274-87. doi: 10.1200/JCO.2005.02.9405. Epub 2005 Dec 19.
44 Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.