Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT67KZJA)

DOT Name Cytosolic 5'-nucleotidase 3A (NT5C3A)
Synonyms
EC 3.1.3.5; 7-methylguanosine phosphate-specific 5'-nucleotidase; 7-methylguanosine nucleotidase; EC 3.1.3.91; Cytosolic 5'-nucleotidase 3; Cytosolic 5'-nucleotidase III; cN-III; Pyrimidine 5'-nucleotidase 1; P5'N-1; P5N-1; PN-I; Uridine 5'-monophosphate hydrolase 1; p36
Gene Name NT5C3A
Related Disease
Carcinoma of esophagus ( )
Esophageal cancer ( )
Hemolytic anemia due to pyrimidine 5' nucleotidase deficiency ( )
Neoplasm of esophagus ( )
Neuroblastoma ( )
Acute myelogenous leukaemia ( )
Alzheimer disease ( )
Bone osteosarcoma ( )
Brain cancer ( )
Brain neoplasm ( )
Breast cancer ( )
Breast carcinoma ( )
Breast neoplasm ( )
Central nervous system neoplasm ( )
Congenital nonspherocytic hemolytic anemia ( )
Crohn disease ( )
Disorder of glycogen metabolism ( )
Ductal carcinoma ( )
Gerstmann-Straussler-Scheinker syndrome ( )
Gilbert syndrome ( )
Glioma ( )
Hemolytic anemia ( )
Hepatocellular carcinoma ( )
Herpes simplex infection ( )
Hyperglycemia ( )
Hyperinsulinemia ( )
Leprosy ( )
Lupus ( )
Mycobacterium infection ( )
Neoplasm ( )
Non-insulin dependent diabetes ( )
Osteosarcoma ( )
Pancreatic cancer ( )
Progressive multifocal leukoencephalopathy ( )
Prostate cancer ( )
Prostate carcinoma ( )
Sarcoidosis ( )
Systemic lupus erythematosus ( )
Advanced cancer ( )
Primitive neuroectodermal tumor ( )
Type-1/2 diabetes ( )
Inflammatory bowel disease ( )
Malaria ( )
Tuberculosis ( )
Ulcerative colitis ( )
UniProt ID
5NT3A_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2CN1; 2JGA; 2VKQ
EC Number
3.1.3.5; 3.1.3.91
Pfam ID
PF05822
Sequence
MRAPSMDRAAVARVGAVASASVCALVAGVVLAQYIFTLKRKTGRKTKIIEMMPEFQKSSV
RIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDEC
RKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVM
LKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLK
GFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYL
NDRVDELLEKYMDSYDIVLVQDESLEVANSILQKIL
Function Nucleotidase which shows specific activity towards cytidine monophosphate (CMP) and 7-methylguanosine monophosphate (m(7)GMP). CMP seems to be the preferred substrate.
Tissue Specificity Isoforms 1, 3 and 4 are expressed in reticulocytes. Isoform 4 is hardly detectable in bone marrow and fetal liver.
KEGG Pathway
Pyrimidine metabolism (hsa00240 )
Metabolic pathways (hsa01100 )
Nucleotide metabolism (hsa01232 )

Molecular Interaction Atlas (MIA) of This DOT

45 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Carcinoma of esophagus DISS6G4D Definitive Biomarker [1]
Esophageal cancer DISGB2VN Definitive Biomarker [1]
Hemolytic anemia due to pyrimidine 5' nucleotidase deficiency DISVBL0U Definitive Autosomal recessive [2]
Neoplasm of esophagus DISOLKAQ Definitive Biomarker [1]
Neuroblastoma DISVZBI4 Definitive Biomarker [3]
Acute myelogenous leukaemia DISCSPTN Strong Genetic Variation [4]
Alzheimer disease DISF8S70 Strong Genetic Variation [5]
Bone osteosarcoma DIST1004 Strong Biomarker [6]
Brain cancer DISBKFB7 Strong Genetic Variation [7]
Brain neoplasm DISY3EKS Strong Biomarker [8]
Breast cancer DIS7DPX1 Strong Biomarker [9]
Breast carcinoma DIS2UE88 Strong Biomarker [9]
Breast neoplasm DISNGJLM Strong Biomarker [10]
Central nervous system neoplasm DISFC18W Strong Genetic Variation [7]
Congenital nonspherocytic hemolytic anemia DISEJNS0 Strong Biomarker [11]
Crohn disease DIS2C5Q8 Strong Biomarker [12]
Disorder of glycogen metabolism DISYGNOB Strong Genetic Variation [13]
Ductal carcinoma DIS15EA5 Strong Biomarker [14]
Gerstmann-Straussler-Scheinker syndrome DISIO6KC Strong Genetic Variation [13]
Gilbert syndrome DISMUZF4 Strong Genetic Variation [15]
Glioma DIS5RPEH Strong Biomarker [16]
Hemolytic anemia DIS803XQ Strong Altered Expression [17]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [18]
Herpes simplex infection DISL1SAV Strong Biomarker [19]
Hyperglycemia DIS0BZB5 Strong Biomarker [20]
Hyperinsulinemia DISIDWT6 Strong Biomarker [21]
Leprosy DISAA4UI Strong Biomarker [22]
Lupus DISOKJWA Strong Biomarker [23]
Mycobacterium infection DISNSMUD Strong Biomarker [22]
Neoplasm DISZKGEW Strong Biomarker [24]
Non-insulin dependent diabetes DISK1O5Z Strong Biomarker [25]
Osteosarcoma DISLQ7E2 Strong Biomarker [6]
Pancreatic cancer DISJC981 Strong Biomarker [9]
Progressive multifocal leukoencephalopathy DISX02WS Strong Biomarker [26]
Prostate cancer DISF190Y Strong Genetic Variation [7]
Prostate carcinoma DISMJPLE Strong Genetic Variation [7]
Sarcoidosis DISE5B8Z Strong Biomarker [22]
Systemic lupus erythematosus DISI1SZ7 Strong Biomarker [23]
Advanced cancer DISAT1Z9 moderate Biomarker [27]
Primitive neuroectodermal tumor DISFHXHA moderate Altered Expression [28]
Type-1/2 diabetes DISIUHAP moderate Altered Expression [29]
Inflammatory bowel disease DISGN23E Limited Biomarker [30]
Malaria DISQ9Y50 Limited Biomarker [31]
Tuberculosis DIS2YIMD Limited Biomarker [30]
Ulcerative colitis DIS8K27O Limited Biomarker [30]
------------------------------------------------------------------------------------
⏷ Show the Full List of 45 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
4 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Cytosolic 5'-nucleotidase 3A (NT5C3A). [32]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Cytosolic 5'-nucleotidase 3A (NT5C3A). [33]
Temozolomide DMKECZD Approved Temozolomide increases the expression of Cytosolic 5'-nucleotidase 3A (NT5C3A). [34]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Cytosolic 5'-nucleotidase 3A (NT5C3A). [35]
------------------------------------------------------------------------------------

References

1 Molecular cloning and characterization of OSR1 on human chromosome 2p24.Int J Mol Med. 2002 Aug;10(2):221-5.
2 Flexible and scalable diagnostic filtering of genomic variants using G2P with Ensembl VEP. Nat Commun. 2019 May 30;10(1):2373. doi: 10.1038/s41467-019-10016-3.
3 Loss of heterozygosity at 1p36 predicts poor prognosis in gastrointestinal stromal/smooth muscle tumors.Lab Invest. 1999 Dec;79(12):1461-7.
4 NT5C3 polymorphisms and outcome of first induction chemotherapy in acute myeloid leukemia.Pharmacogenet Genomics. 2014 Sep;24(9):436-41. doi: 10.1097/FPC.0000000000000072.
5 Association between presenilin-1 -48C/T polymorphism and Down's syndrome.Neurosci Lett. 2004 Aug 26;367(1):88-91. doi: 10.1016/j.neulet.2004.05.086.
6 Comparative genomic hybridization analysis identifies gains of 1p35 approximately p36 and chromosome 19 in osteosarcoma.Cancer Genet Cytogenet. 2001 Oct 1;130(1):14-21. doi: 10.1016/s0165-4608(01)00461-7.
7 Germline mutations in the p73 gene do not predispose to familial prostate-brain cancer.Prostate. 2001 Sep 15;48(4):292-6. doi: 10.1002/pros.1109.
8 Mutation analysis of the p73 gene in nonastrocytic brain tumours.Br J Cancer. 2001 Jul 20;85(2):204-8. doi: 10.1054/bjoc.2001.1855.
9 Labdane diterpenoids from Curcuma amada rhizomes collected in Myanmar and their antiproliferative activities.Fitoterapia. 2017 Oct;122:34-39. doi: 10.1016/j.fitote.2017.08.006. Epub 2017 Aug 18.
10 Depletion of signal recognition particle 72kDa increases radiosensitivity.Cancer Biol Ther. 2017 Jun 3;18(6):425-432. doi: 10.1080/15384047.2017.1323587. Epub 2017 May 11.
11 Structure of pyrimidine 5'-nucleotidase type 1. Insight into mechanism of action and inhibition during lead poisoning.J Biol Chem. 2006 Jul 21;281(29):20521-9. doi: 10.1074/jbc.M602000200. Epub 2006 May 3.
12 Specific seroreactivity of Crohn's disease patients against p35 and p36 antigens of M. avium subsp. paratuberculosis.Vet Microbiol. 2000 Dec 20;77(3-4):497-504. doi: 10.1016/s0378-1135(00)00334-5.
13 New lessons in the regulation of glucose metabolism taught by the glucose 6-phosphatase system.Eur J Biochem. 2000 Mar;267(6):1533-49. doi: 10.1046/j.1432-1327.2000.01160.x.
14 Cytogenetic and comparative genomic hybridization findings in four cases of breast cancer after neoadjuvant chemotherapy.Cancer Genet Cytogenet. 2003 Oct 15;146(2):161-6. doi: 10.1016/s0165-4608(03)00144-4.
15 Pyrimidine-5'-nucleotidase Campinas, a new mutation (p.R56G) in the NT5C3 gene associated with pyrimidine-5'-nucleotidase type I deficiency and influence of Gilbert's Syndrome on clinical expression.Blood Cells Mol Dis. 2014 Dec;53(4):246-52. doi: 10.1016/j.bcmd.2014.05.009. Epub 2014 Aug 18.
16 Crotoxin from Crotalus durissus terrificus venom: In vitro cytotoxic activity of a heterodimeric phospholipase A(2) on human cancer-derived cell lines.Toxicon. 2018 Dec 15;156:13-22. doi: 10.1016/j.toxicon.2018.10.306. Epub 2018 Nov 2.
17 Molecular basis of pyrimidine 5'-nucleotidase deficiency caused by 3 newly identified missense mutations (c.187T>C, c.469G>C and c.740T>C) and a tabulation of known mutations.Blood Cells Mol Dis. 2008 May-Jun;40(3):295-301. doi: 10.1016/j.bcmd.2007.10.005.
18 Effect of ethanol on p36 protein kinase substrate and insulin receptor substrate 1 expression and tyrosyl phosphorylation in human hepatocellular carcinoma cells.Alcohol Clin Exp Res. 1995 Apr;19(2):441-6. doi: 10.1111/j.1530-0277.1995.tb01528.x.
19 Retrovirus-mediated herpes simplex virus thymidine kinase gene transfer in pancreatic cancer cell lines: an incomplete antitumor effect.Pancreas. 2002 Aug;25(2):e21-9. doi: 10.1097/00006676-200208000-00020.
20 Effects on the Caco-2 Cells of a Hypoglycemic Protein from Lupin Seeds in a Solution and Adsorbed on Polystyrene Nanoparticles to Mimic a Complex Food Matrix.Biomolecules. 2019 Oct 14;9(10):606. doi: 10.3390/biom9100606.
21 Short-Term Effects of Lupin vs. Whey Supplementation on Glucose and Insulin Responses to a Standardized Meal in a Randomized Cross-Over Trial.Front Physiol. 2017 Apr 10;8:198. doi: 10.3389/fphys.2017.00198. eCollection 2017.
22 Identification of Mycobacterium avium complex in sarcoidosis.J Clin Microbiol. 1996 Sep;34(9):2240-5. doi: 10.1128/jcm.34.9.2240-2245.1996.
23 Purification, microsequencing, and immunolocalization of p36, a new interferon-alpha-induced protein that is associated with human lupus inclusions.J Biol Chem. 1996 Jan 12;271(2):1118-26. doi: 10.1074/jbc.271.2.1118.
24 Partial deletion of chromosome 1 in a case of acute myelocytic leukemia.Cancer Genet Cytogenet. 2002 Nov;139(1):60-2. doi: 10.1016/s0165-4608(02)00597-6.
25 Lupin seed hydrolysate promotes G-protein-coupled receptor, intracellular Ca(2+) and enhanced glycolytic metabolism-mediated insulin secretion from BRIN-BD11 pancreatic beta cells.Mol Cell Endocrinol. 2019 Jan 15;480:83-96. doi: 10.1016/j.mce.2018.10.015. Epub 2018 Oct 19.
26 Chimeric immune receptors (CIRs) specific to JC virus for immunotherapy in progressive multifocal leukoencephalopathy (PML).Int Immunol. 2007 Sep;19(9):1083-93. doi: 10.1093/intimm/dxm076. Epub 2007 Jul 28.
27 Three new abietane-type diterpenoids from the leaves of Indonesian Plectranthus scutellarioides.Fitoterapia. 2018 Jun;127:146-150. doi: 10.1016/j.fitote.2018.02.013. Epub 2018 Feb 12.
28 Modulation of p36 gene expression in human neuronal cells.J Neurol Sci. 1995 Feb;128(2):122-33. doi: 10.1016/0022-510x(94)00218-d.
29 Diabetes affects similarly the catalytic subunit and putative glucose-6-phosphate translocase of glucose-6-phosphatase.J Biol Chem. 1999 Nov 26;274(48):33866-8. doi: 10.1074/jbc.274.48.33866.
30 Characterization of Mycobacterium paratuberculosis p36 antigen and its seroreactivities in Crohn's disease.Curr Microbiol. 1999 Aug;39(2):115-9. doi: 10.1007/s002849900430.
31 Cracking Ali Baba's code.Elife. 2017 Jun 14;6:e28600. doi: 10.7554/eLife.28600.
32 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
33 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
34 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
35 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.